Packages - ActiveState ActiveGo 1.8

Packages

Standard library and community packages
Go sub-repository packages: Resources for additional community packages

Standard library and community packages included in ActiveGo

For a complete list of package versions, or Git tags identifying the package contents, see ActiveGo-packages.txt in your ActiveGo root directory.

Name	Synopsis
archive
tar	Package tar implements access to tar archives.
zip	Package zip provides support for reading and writing ZIP archives.
bufio	Package bufio implements buffered I/O. It wraps an io.Reader or io.Writer object, creating another object (Reader or Writer) that also implements the interface but provides buffering and some help for textual I/O.
builtin	Package builtin provides documentation for Go's predeclared identifiers.
bytes	Package bytes implements functions for the manipulation of byte slices.
cloud.google.com
go	Package cloud is the root of the packages used to access Google Cloud Services.
bigquery	Package bigquery provides a client for the BigQuery service.
bigtable	Package bigtable is an API to Google Cloud Bigtable.
bttest	Package bttest contains test helpers for working with the bigtable package.
cmd
cbt	Cbt is a tool for doing basic interactions with Cloud Bigtable.
emulator	cbtemulator launches the in-memory Cloud Bigtable server on the given address.
loadtest	Loadtest does some load testing through the Go client library for Cloud Bigtable.
scantest	Scantest does scan-related load testing against Cloud Bigtable.
civil	Package civil implements types for civil time, a time-zone-independent representation of time that follows the rules of the proleptic Gregorian calendar with exactly 24-hour days, 60-minute hours, and 60-second minutes.
cmd
go-cloud-debug-agent
compute
metadata	Package metadata provides access to Google Compute Engine (GCE) metadata and API service accounts.
container	Package container contains a deprecated Google Container Engine client.
datastore	Package datastore provides a client for Google Cloud Datastore.
debugger
apiv2	Package debugger is an experimental, auto-generated package for the debugger API.
errorreporting
apiv1beta1	Package errorreporting is an experimental, auto-generated package for the errorreporting API.
errors	Package errors is a Google Stackdriver Error Reporting library.
iam	Package iam supports the resource-specific operations of Google Cloud IAM (Identity and Access Management) for the Google Cloud Libraries.
admin
apiv1	Package admin is an experimental, auto-generated package for the admin API.
language
apiv1	Package language is an experimental, auto-generated package for the language API.
apiv1beta2	Package language is an experimental, auto-generated package for the language API.
logging	Package logging contains a Stackdriver Logging client suitable for writing logs.
apiv2	Package logging is an experimental, auto-generated package for the logging API.
logadmin	Package logadmin contains a Stackdriver Logging client that can be used for reading logs and working with sinks, metrics and monitored resources.
longrunning	Package longrunning supports Long Running Operations for the Google Cloud Libraries.
autogen	Package longrunning is an experimental, auto-generated package for the longrunning API.
monitoring
apiv3	Package monitoring is an experimental, auto-generated package for the monitoring API.
profiler	Package profiler is a client for the Google Cloud Profiler service.
mocks
pubsub	Package pubsub provides an easy way to publish and receive Google Cloud Pub/Sub messages, hiding the the details of the underlying server RPCs.
apiv1	Package pubsub is an experimental, auto-generated package for the pubsub API.
loadtest	Package loadtest implements load testing for pubsub, following the interface defined in https://github.com/GoogleCloudPlatform/pubsub/tree/master/load-test-framework/ .
cmd
pb	Package google_pubsub_loadtest is a generated protocol buffer package.
spanner	Package spanner provides a client for reading and writing to Cloud Spanner databases.
admin
database
apiv1	Package database is an experimental, auto-generated package for the database API.
instance
apiv1	Package instance is an experimental, auto-generated package for the instance API.
speech
apiv1	Package speech is an experimental, auto-generated package for the speech API.
apiv1beta1	Package speech is an experimental, auto-generated package for the speech API.
storage	Package storage provides an easy way to work with Google Cloud Storage.
trace	Package trace is a Google Stackdriver Trace library.
apiv1	Package trace is an experimental, auto-generated package for the trace API.
translate	Package translate is a client for the Google Translation API.
videointelligence
apiv1beta1	Package videointelligence is an experimental, auto-generated package for the videointelligence API.
vision	Package vision provides a client for the Google Cloud Vision API.
apiv1	Package vision is an experimental, auto-generated package for the vision API.
compress
bzip2	Package bzip2 implements bzip2 decompression.
flate	Package flate implements the DEFLATE compressed data format, described in RFC 1951.
gzip	Package gzip implements reading and writing of gzip format compressed files, as specified in RFC 1952.
lzw	Package lzw implements the Lempel-Ziv-Welch compressed data format, described in T. A. Welch, ``A Technique for High-Performance Data Compression'', Computer, 17(6) (June 1984), pp 8-19.
zlib	Package zlib implements reading and writing of zlib format compressed data, as specified in RFC 1950.
container
heap	Package heap provides heap operations for any type that implements heap.Interface.
list	Package list implements a doubly linked list.
ring	Package ring implements operations on circular lists.
context	Package context defines the Context type, which carries deadlines, cancelation signals, and other request-scoped values across API boundaries and between processes.
crypto	Package crypto collects common cryptographic constants.
aes	Package aes implements AES encryption (formerly Rijndael), as defined in U.S. Federal Information Processing Standards Publication 197.
cipher	Package cipher implements standard block cipher modes that can be wrapped around low-level block cipher implementations.
des	Package des implements the Data Encryption Standard (DES) and the Triple Data Encryption Algorithm (TDEA) as defined in U.S. Federal Information Processing Standards Publication 46-3.
dsa	Package dsa implements the Digital Signature Algorithm, as defined in FIPS 186-3.
ecdsa	Package ecdsa implements the Elliptic Curve Digital Signature Algorithm, as defined in FIPS 186-3.
elliptic	Package elliptic implements several standard elliptic curves over prime fields.
hmac	Package hmac implements the Keyed-Hash Message Authentication Code (HMAC) as defined in U.S. Federal Information Processing Standards Publication 198.
md5	Package md5 implements the MD5 hash algorithm as defined in RFC 1321.
rand	Package rand implements a cryptographically secure pseudorandom number generator.
rc4	Package rc4 implements RC4 encryption, as defined in Bruce Schneier's Applied Cryptography.
rsa	Package rsa implements RSA encryption as specified in PKCS#1.
sha1	Package sha1 implements the SHA1 hash algorithm as defined in RFC 3174.
sha256	Package sha256 implements the SHA224 and SHA256 hash algorithms as defined in FIPS 180-4.
sha512	Package sha512 implements the SHA-384, SHA-512, SHA-512/224, and SHA-512/256 hash algorithms as defined in FIPS 180-4.
subtle	Package subtle implements functions that are often useful in cryptographic code but require careful thought to use correctly.
tls	Package tls partially implements TLS 1.2, as specified in RFC 5246.
x509	Package x509 parses X.509-encoded keys and certificates.
pkix	Package pkix contains shared, low level structures used for ASN.1 parsing and serialization of X.509 certificates, CRL and OCSP.
database
sql	Package sql provides a generic interface around SQL (or SQL-like) databases.
driver	Package driver defines interfaces to be implemented by database drivers as used by package sql.
debug
dwarf	Package dwarf provides access to DWARF debugging information loaded from executable files, as defined in the DWARF 2.0 Standard at http://dwarfstd.org/doc/dwarf-2.0.0.pdf
elf	Package elf implements access to ELF object files.
gosym	Package gosym implements access to the Go symbol and line number tables embedded in Go binaries generated by the gc compilers.
macho	Package macho implements access to Mach-O object files.
pe	Package pe implements access to PE (Microsoft Windows Portable Executable) files.
plan9obj	Package plan9obj implements access to Plan 9 a.out object files.
encoding	Package encoding defines interfaces shared by other packages that convert data to and from byte-level and textual representations.
ascii85	Package ascii85 implements the ascii85 data encoding as used in the btoa tool and Adobe's PostScript and PDF document formats.
asn1	Package asn1 implements parsing of DER-encoded ASN.1 data structures, as defined in ITU-T Rec X.690.
base32	Package base32 implements base32 encoding as specified by RFC 4648.
base64	Package base64 implements base64 encoding as specified by RFC 4648.
binary	Package binary implements simple translation between numbers and byte sequences and encoding and decoding of varints.
csv	Package csv reads and writes comma-separated values (CSV) files.
gob	Package gob manages streams of gobs - binary values exchanged between an Encoder (transmitter) and a Decoder (receiver).
hex	Package hex implements hexadecimal encoding and decoding.
json	Package json implements encoding and decoding of JSON as defined in RFC 4627.
pem	Package pem implements the PEM data encoding, which originated in Privacy Enhanced Mail.
xml	Package xml implements a simple XML 1.0 parser that understands XML name spaces.
errors	Package errors implements functions to manipulate errors.
expvar	Package expvar provides a standardized interface to public variables, such as operation counters in servers.
flag	Package flag implements command-line flag parsing.
fmt	Package fmt implements formatted I/O with functions analogous to C's printf and scanf.
github.com
Shopify
sarama	Package sarama is a pure Go client library for dealing with Apache Kafka (versions 0.8 and later).
examples
http_server
mocks	Package mocks provides mocks that can be used for testing applications that use Sarama.
tools
kafka-console-consumer
kafka-console-partitionconsumer
kafka-console-producer
toxiproxy
cli
client	Package Toxiproxy provides a client wrapper around the Toxiproxy HTTP API for testing the resiliency of Go applications.
cmd
stream
testhelper
testing
toxics
VividCortex
gohistogram	Package gohistogram contains implementations of weighted and exponential histograms.
afex
hystrix-go
hystrix	Package hystrix is a latency and fault tolerance library designed to isolate points of access to remote systems, services and 3rd party libraries, stop cascading failure and enable resilience in complex distributed systems where failure is inevitable.
metric_collector
rolling
loadtest
service	Package main implements an http server which executes a hystrix command each request and sends metrics to a statsd instance to aid performance testing.
plugins	Plugins allows users to operate on statistics recorded for each circuit operation.
apache
thrift
lib
go
test
tests
thrift
test
go
src
bin
stress
testclient
testserver
common
tutorial
go
src
aws
aws-sdk-go	Package sdk is the official AWS SDK for the Go programming language.
aws	Package aws provides the core SDK's utilities and shared types.
awserr	Package awserr represents API error interface accessors for the SDK.
awsutil
client
metadata
corehandlers
credentials	Package credentials provides credential retrieval and management The Credentials is the primary method of getting access to and managing credentials Values.
ec2rolecreds
endpointcreds	Package endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint.
stscreds	Package stscreds are credential Providers to retrieve STS AWS credentials.
defaults	Package defaults is a collection of helpers to retrieve the SDK's default configuration and handlers.
ec2metadata	Package ec2metadata provides the client for making API calls to the EC2 Metadata service.
endpoints	Package endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions.
request
session	Package session provides configuration for the SDK's service clients.
signer
v4	Package v4 implements signing for AWS V4 signer Provides request signing for request that need to be signed with AWS V4 Signatures.
awsmigrate
awsmigrate-renamer
gen
rename
awstesting
cmd
bucket_cleanup
integration	Package integration performs initialization and validation for integration tests.
customizations
s3
s3crypto	Package s3crypto provides gucumber integration tests support.
s3manager
smoke	Package smoke contains shared step definitions that are used across integration tests
acm	Package acm provides gucumber integration tests support.
apigateway	Package apigateway provides gucumber integration tests support.
applicationdiscoveryservice	Package applicationdiscoveryservice provides gucumber integration tests support.
autoscaling	Package autoscaling provides gucumber integration tests support.
cloudformation	Package cloudformation provides gucumber integration tests support.
cloudfront	Package cloudfront provides gucumber integration tests support.
cloudhsm	Package cloudhsm provides gucumber integration tests support.
cloudsearch	Package cloudsearch provides gucumber integration tests support.
cloudtrail	Package cloudtrail provides gucumber integration tests support.
cloudwatch	Package cloudwatch provides gucumber integration tests support.
cloudwatchlogs	Package cloudwatchlogs provides gucumber integration tests support.
codecommit	Package codecommit provides gucumber integration tests support.
codedeploy	Package codedeploy provides gucumber integration tests support.
codepipeline	Package codepipeline provides gucumber integration tests support.
cognitoidentity	Package cognitoidentity provides gucumber integration tests support.
cognitosync	Package cognitosync provides gucumber integration tests support.
configservice	Package configservice provides gucumber integration tests support.
datapipeline	Package datapipeline provides gucumber integration tests support.
devicefarm	Package devicefarm provides gucumber integration tests support.
directconnect	Package directconnect provides gucumber integration tests support.
directoryservice	Package directoryservice provides gucumber integration tests support.
dynamodb	Package dynamodb provides gucumber integration tests support.
dynamodbstreams	Package dynamodbstreams provides gucumber integration tests support.
ec2	Package ec2 provides gucumber integration tests support.
ecs	Package ecs provides gucumber integration tests support.
efs	Package efs provides gucumber integration tests support.
elasticache	Package elasticache provides gucumber integration tests support.
elasticbeanstalk	Package elasticbeanstalk provides gucumber integration tests support.
elasticloadbalancing	Package elasticloadbalancing provides gucumber integration tests support.
elastictranscoder	Package elastictranscoder provides gucumber integration tests support.
emr	Package emr provides gucumber integration tests support.
es	Package es provides gucumber integration tests support.
glacier	Package glacier provides gucumber integration tests support.
iam	Package iam provides gucumber integration tests support.
iotdataplane	Package iotdataplane provides gucumber integration tests support.
kinesis	Package kinesis provides gucumber integration tests support.
kms	Package kms provides gucumber integration tests support.
lambda	Package lambda provides gucumber integration tests support.
machinelearning	Package machinelearning provides gucumber integration tests support.
opsworks	Package opsworks provides gucumber integration tests support.
rds	Package rds provides gucumber integration tests support.
redshift	Package redshift provides gucumber integration tests support.
route53	Package route53 provides gucumber integration tests support.
route53domains	Package route53domains provides gucumber integration tests support.
ses	Package ses provides gucumber integration tests support.
simpledb	Package simpledb provides gucumber integration tests support.
sns	Package sns provides gucumber integration tests support.
sqs	Package sqs provides gucumber integration tests support.
ssm	Package ssm provides gucumber integration tests support.
storagegateway	Package storagegateway provides gucumber integration tests support.
sts	Package sts provides gucumber integration tests support.
support	Package support provides gucumber integration tests support.
swf	Package swf provides gucumber integration tests support.
waf	Package waf provides gucumber integration tests support.
workspaces	Package workspaces provides gucumber integration tests support.
mock
performance	Package performance provides gucumber integration tests support.
unit	Package unit performs initialization and validation for unit tests
example
aws
endpoints
customEndpoint
enumEndpoints
request
handleServiceErrorCodes
withContext
service
cloudfront
signCookies
dynamodb
scanItems
unitTest	Package unitTest demonstrates how to unit test, without needing to pass a connector to every function, code that uses DynamoDB.
ec2
filterInstances
rds
rdsutils
authentication
s3
concatObjects
listObjects
listObjectsConcurrently
presignURL
client
server
putObjectAcl
sqs
mockingClientsForTests
models
endpoints	Package endpoints contains the models for endpoints that should be used to generate endpoint definition files for the SDK.
protocol_tests
private
model
api	Package api represents API abstractions for rendering service generated files.
cli
api-info
gen-api	Command aws-gen-gocli parses a JSON description of an AWS API and generates a Go file containing a client for the API.
gen-endpoints	Command gen-endpoints parses a JSON description of the AWS endpoint discovery logic and generates a Go file which returns an endpoint.
protocol
ec2query	Package ec2query provides serialization of AWS EC2 requests and responses.
json
jsonutil	Package jsonutil provides JSON serialization of AWS requests and responses.
jsonrpc	Package jsonrpc provides JSON RPC utilities for serialization of AWS requests and responses.
query	Package query provides serialization of AWS query requests, and responses.
queryutil
rest	Package rest provides RESTful serialization of AWS requests and responses.
restjson	Package restjson provides RESTful JSON serialization of AWS requests and responses.
restxml	Package restxml provides RESTful XML serialization of AWS requests and responses.
xml
xmlutil	Package xmlutil provides XML serialization of AWS requests and responses.
signer
v2
util
service	Package service contains automatically generated AWS clients.
acm	Package acm provides the client and types for making API requests to AWS Certificate Manager.
acmiface	Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
apigateway	Package apigateway provides the client and types for making API requests to Amazon API Gateway.
apigatewayiface	Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
applicationautoscaling	Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
applicationautoscalingiface	Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
applicationdiscoveryservice	Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
applicationdiscoveryserviceiface	Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
appstream	Package appstream provides the client and types for making API requests to Amazon AppStream.
appstreamiface	Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
athena	Package athena provides the client and types for making API requests to Amazon Athena.
athenaiface	Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
autoscaling	Package autoscaling provides the client and types for making API requests to Auto Scaling.
autoscalingiface	Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
batch	Package batch provides the client and types for making API requests to AWS Batch.
batchiface	Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
budgets	Package budgets provides the client and types for making API requests to AWS Budgets.
budgetsiface	Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
clouddirectory	Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
clouddirectoryiface	Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
cloudformation	Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
cloudformationiface	Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
cloudfront	Package cloudfront provides the client and types for making API requests to Amazon CloudFront.
cloudfrontiface	Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
sign	Package sign provides utilities to generate signed URLs for Amazon CloudFront.
cloudhsm	Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM.
cloudhsmiface	Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
cloudsearch	Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
cloudsearchiface	Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
cloudsearchdomain	Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
cloudsearchdomainiface	Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
cloudtrail	Package cloudtrail provides the client and types for making API requests to AWS CloudTrail.
cloudtrailiface	Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
cloudwatch	Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch.
cloudwatchiface	Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
cloudwatchevents	Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
cloudwatcheventsiface	Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
cloudwatchlogs	Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
cloudwatchlogsiface	Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
codebuild	Package codebuild provides the client and types for making API requests to AWS CodeBuild.
codebuildiface	Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
codecommit	Package codecommit provides the client and types for making API requests to AWS CodeCommit.
codecommitiface	Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
codedeploy	Package codedeploy provides the client and types for making API requests to AWS CodeDeploy.
codedeployiface	Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
codepipeline	Package codepipeline provides the client and types for making API requests to AWS CodePipeline.
codepipelineiface	Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
codestar	Package codestar provides the client and types for making API requests to AWS CodeStar.
codestariface	Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
cognitoidentity	Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
cognitoidentityiface	Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
cognitoidentityprovider	Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
cognitoidentityprovideriface	Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
cognitosync	Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
cognitosynciface	Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
configservice	Package configservice provides the client and types for making API requests to AWS Config.
configserviceiface	Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
costandusagereportservice	Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
costandusagereportserviceiface	Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
databasemigrationservice	Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
databasemigrationserviceiface	Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
datapipeline	Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
datapipelineiface	Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
devicefarm	Package devicefarm provides the client and types for making API requests to AWS Device Farm.
devicefarmiface	Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
directconnect	Package directconnect provides the client and types for making API requests to AWS Direct Connect.
directconnectiface	Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
directoryservice	Package directoryservice provides the client and types for making API requests to AWS Directory Service.
directoryserviceiface	Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
dynamodb	Package dynamodb provides the client and types for making API requests to Amazon DynamoDB.
dynamodbattribute	Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
dynamodbiface	Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
dynamodbstreams	Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
dynamodbstreamsiface	Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
ec2	Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.
ec2iface	Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
ecr	Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry.
ecriface	Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
ecs	Package ecs provides the client and types for making API requests to Amazon EC2 Container Service.
ecsiface	Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
efs	Package efs provides the client and types for making API requests to Amazon Elastic File System.
efsiface	Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
elasticache	Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
elasticacheiface	Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
elasticbeanstalk	Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.
elasticbeanstalkiface	Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
elasticsearchservice	Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
elasticsearchserviceiface	Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
elastictranscoder	Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
elastictranscoderiface	Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
elb	Package elb provides the client and types for making API requests to Elastic Load Balancing.
elbiface	Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
elbv2	Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.
elbv2iface	Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
emr	Package emr provides the client and types for making API requests to Amazon Elastic MapReduce.
emriface	Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
firehose	Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose.
firehoseiface	Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
gamelift	Package gamelift provides the client and types for making API requests to Amazon GameLift.
gameliftiface	Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
glacier	Package glacier provides the client and types for making API requests to Amazon Glacier.
glacieriface	Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
greengrass	Package greengrass provides the client and types for making API requests to AWS Greengrass.
greengrassiface	Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
health	Package health provides the client and types for making API requests to AWS Health APIs and Notifications.
healthiface	Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
iam	Package iam provides the client and types for making API requests to AWS Identity and Access Management.
iamiface	Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
inspector	Package inspector provides the client and types for making API requests to Amazon Inspector.
inspectoriface	Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
iot	Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected things (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud.
iotiface	Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
iotdataplane	Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
iotdataplaneiface	Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
kinesis	Package kinesis provides the client and types for making API requests to Amazon Kinesis.
kinesisiface	Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
kinesisanalytics	Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.
kinesisanalyticsiface	Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
kms	Package kms provides the client and types for making API requests to AWS Key Management Service.
kmsiface	Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
lambda	Package lambda provides the client and types for making API requests to AWS Lambda.
lambdaiface	Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
lexmodelbuildingservice	Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
lexmodelbuildingserviceiface	Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
lexruntimeservice	Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
lexruntimeserviceiface	Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
lightsail	Package lightsail provides the client and types for making API requests to Amazon Lightsail.
lightsailiface	Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
machinelearning	Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
machinelearningiface	Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
marketplacecommerceanalytics	Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
marketplacecommerceanalyticsiface	Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
marketplaceentitlementservice	Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
marketplaceentitlementserviceiface	Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
marketplacemetering	Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
marketplacemeteringiface	Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
mobileanalytics	Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
mobileanalyticsiface	Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
mturk	Package mturk provides the client and types for making API requests to Amazon Mechanical Turk.
mturkiface	Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
opsworks	Package opsworks provides the client and types for making API requests to AWS OpsWorks.
opsworksiface	Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
opsworkscm	Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate.
opsworkscmiface	Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code.
organizations	Package organizations provides the client and types for making API requests to AWS Organizations.
organizationsiface	Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
pinpoint	Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
pinpointiface	Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
polly	Package polly provides the client and types for making API requests to Amazon Polly.
pollyiface	Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
rds	Package rds provides the client and types for making API requests to Amazon Relational Database Service.
rdsiface	Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
rdsutils
redshift	Package redshift provides the client and types for making API requests to Amazon Redshift.
redshiftiface	Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
rekognition	Package rekognition provides the client and types for making API requests to Amazon Rekognition.
rekognitioniface	Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
resourcegroupstaggingapi	Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
resourcegroupstaggingapiiface	Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
route53	Package route53 provides the client and types for making API requests to Amazon Route 53.
route53iface	Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
route53domains	Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
route53domainsiface	Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
s3	Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.
s3crypto	Package s3crypto provides encryption to S3 using KMS and AES GCM.
s3iface	Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
s3manager	Package s3manager provides utilities to upload and download objects from S3 concurrently.
s3manageriface	Package s3manageriface provides an interface for the s3manager package
servicecatalog	Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
servicecatalogiface	Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
ses	Package ses provides the client and types for making API requests to Amazon Simple Email Service.
sesiface	Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
sfn	Package sfn provides the client and types for making API requests to AWS Step Functions.
sfniface	Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
shield	Package shield provides the client and types for making API requests to AWS Shield.
shieldiface	Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
simpledb	Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
simpledbiface	Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
sms	Package sms provides the client and types for making API requests to AWS Server Migration Service.
smsiface	Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
snowball	Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball.
snowballiface	Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
sns	Package sns provides the client and types for making API requests to Amazon Simple Notification Service.
snsiface	Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
sqs	Package sqs provides the client and types for making API requests to Amazon Simple Queue Service.
sqsiface	Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
ssm	Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).
ssmiface	Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
storagegateway	Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
storagegatewayiface	Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
sts	Package sts provides the client and types for making API requests to AWS Security Token Service.
stsiface	Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
support	Package support provides the client and types for making API requests to AWS Support.
supportiface	Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
swf	Package swf provides the client and types for making API requests to Amazon Simple Workflow Service.
swfiface	Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
waf	Package waf provides the client and types for making API requests to AWS WAF.
wafiface	Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
wafregional	Package wafregional provides the client and types for making API requests to AWS WAF Regional.
wafregionaliface	Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
workdocs	Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
workdocsiface	Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
workspaces	Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
workspacesiface	Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
xray	Package xray provides the client and types for making API requests to AWS X-Ray.
xrayiface	Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.
beorn7
perks
histogram	Package histogram provides a Go implementation of BigML's histogram package for Clojure/Java.
quantile	Package quantile computes approximate quantiles over an unbounded data stream within low memory and CPU bounds.
topk
bradfitz
gomemcache
memcache	Package memcache provides a client for the memcached cache server.
coreos
etcd	Package main is a simple wrapper of the real etcd entrypoint package (located at github.com/coreos/etcd/etcdmain) to ensure that etcd is still "go getable"; e.g.
alarm	Package alarm manages health status alarms in etcd.
auth	Package auth provides client role authentication for accessing keys in etcd.
authpb	Package authpb is a generated protocol buffer package.
client	Package client provides bindings for the etcd APIs.
integration	Package integration implements tests built upon embedded etcd, focusing on the correctness of the etcd v2 client.
clientv3	Package clientv3 implements the official Go etcd client for v3.
clientv3util	Package clientv3util contains utility functions derived from clientv3.
concurrency	Package concurrency implements concurrency operations on top of etcd such as distributed locks, barriers, and elections.
integration	Package integration implements tests built upon embedded etcd, and focuses on correctness of etcd client.
mirror	Package mirror implements etcd mirroring operations.
namespace	Package namespace is a clientv3 wrapper that translates all keys to begin with a given prefix.
naming	Package naming provides an etcd-backed gRPC resolver for discovering gRPC services.
yaml	Package yaml handles yaml-formatted clientv3 configuration data.
cmd
compactor	Package compactor implements automated policies for compacting etcd's mvcc storage.
contrib
raftexample	raftexample is a simple KV store using the raft and rafthttp libraries.
recipes	Package recipe contains experimental client-side distributed synchronization primitives.
systemd
etcd2-backup-coreos
discovery	Package discovery provides an implementation of the cluster discovery that is used by etcd.
e2e	Package e2e implements tests built upon etcd binaries, and focus on end-to-end testing.
embed	Package embed provides bindings for embedding an etcd server in a program.
error	Package error describes errors in etcd project.
etcdctl	etcdctl is a command line application that controls etcd.
ctlv2	Package ctlv2 contains the main entry point for the etcdctl for v2 API.
command	Package command is a set of libraries for etcdctl commands.
ctlv3	Package ctlv3 contains the main entry point for the etcdctl for v3 API.
command	Package command is a set of libraries for etcd v3 commands.
etcdmain	Package etcdmain contains the main entry point for the etcd binary.
etcdserver	Package etcdserver defines how etcd servers interact and store their states.
api	Package api manages the capabilities and features that are exposed to clients by the etcd cluster.
v2http	Package v2http provides etcd client and server implementations.
httptypes	Package httptypes defines how etcd's HTTP API entities are serialized to and deserialized from JSON.
v3client	Package v3client provides clientv3 interfaces from an etcdserver.
v3election	Package v3election provides a v3 election service from an etcdserver.
v3electionpb	Package v3electionpb is a generated protocol buffer package.
gw	Package v3electionpb is a reverse proxy.
v3lock	Package v3lock provides a v3 locking service from an etcdserver.
v3lockpb	Package v3lockpb is a generated protocol buffer package.
gw	Package v3lockpb is a reverse proxy.
v3rpc	Package v3rpc implements etcd v3 RPC system based on gRPC.
rpctypes	Package rpctypes has types and values shared by the etcd server and client for v3 RPC interaction.
auth	Package auth implements etcd authentication.
etcdserverpb	Package etcdserverpb is a generated protocol buffer package.
gw	Package etcdserverpb is a reverse proxy.
membership	Package membership describes individual etcd members and clusters of members.
stats	Package stats defines a standard interface for etcd cluster statistics.
integration	Package integration implements tests built upon embedded etcd, and focus on etcd correctness.
lease	Package lease provides an interface and implemetation for time-limited leases over arbitrary resources.
leasehttp	Package leasehttp serves lease renewals made through HTTP requests.
leasepb	Package leasepb is a generated protocol buffer package.
mvcc	Package mvcc defines etcd's stable MVCC storage.
backend	Package backend defines a standard interface for etcd's backend MVCC storage.
mvccpb	Package mvccpb is a generated protocol buffer package.
pkg
adt	Package adt implements useful abstract data types.
contention	Package contention provides facilities for detecting system contention.
cors	Package cors handles cross-origin HTTP requests (CORS).
cpuutil	Package cpuutil provides facilities for detecting cpu-specific features.
crc	Package crc provides utility function for cyclic redundancy check algorithms.
debugutil	Package debugutil includes utility functions for debugging.
expect	Package expect implements a small expect-style interface
fileutil	Package fileutil implements utility functions related to files and paths.
flags	Package flags implements command-line flag parsing.
httputil	Package httputil provides HTTP utility functions.
idutil	Package idutil implements utility functions for generating unique, randomized ids.
ioutil	Package ioutil implements I/O utility functions.
logutil	Package logutil includes utilities to facilitate logging.
mock
mockstorage	Package mockstorage provides mock implementations for etcdserver's storage interface.
mockstore	Package mockstore provides mock structures for the etcd store package.
mockwait	Package mockwait provides mock implementations for pkg/wait.
monotime	Package monotime provides a fast monotonic clock source.
netutil	Package netutil implements network-related utility functions.
osutil	Package osutil implements operating system-related utility functions.
pathutil	Package pathutil implements utility functions for handling slash-separated paths.
pbutil	Package pbutil defines interfaces for handling Protocol Buffer objects.
report	Package report generates human-readable benchmark reports.
runtime	Package runtime implements utility functions for runtime systems.
schedule	Package schedule provides mechanisms and policies for scheduling units of work.
srv	Package srv looks up DNS SRV records.
stringutil	Package stringutil exports string utility functions.
testutil	Package testutil provides test utility functions.
tlsutil	Package tlsutil provides utility functions for handling TLS.
transport	Package transport implements various HTTP transport utilities based on Go net package.
types	Package types declares various data types and implements type-checking functions.
wait	Package wait provides utility functions for polling, listening using Go channel.
proxy
grpcproxy	Package grpcproxy is an OSI level 7 proxy for etcd v3 API requests.
adapter	Package adapter provides gRPC adapters between client and server gRPC interfaces without needing to go through a gRPC connection.
cache	Package cache exports functionality for efficiently caching and mapping `RangeRequest`s to corresponding `RangeResponse`s.
httpproxy	Package httpproxy implements etcd httpproxy.
tcpproxy	Package tcpproxy is an OSI level 4 proxy for routing etcd clients to etcd servers.
raft	Package raft sends and receives messages in the Protocol Buffer format defined in the raftpb package.
raftpb	Package raftpb is a generated protocol buffer package.
rafttest	Package rafttest provides functional tests for etcd's raft implementation.
rafthttp	Package rafthttp implements HTTP transportation layer for etcd/raft pkg.
snap	Package snap stores raft nodes' states with snapshots.
snappb	Package snappb is a generated protocol buffer package.
store	Package store defines etcd's in-memory key/value store.
tools
benchmark	benchmark is a program for benchmarking etcd v3 API performance.
cmd	Package cmd implements individual benchmark commands for the benchmark utility.
etcd-dump-db	etcd-dump-db inspects etcd db files.
etcd-dump-logs	etcd-dump-logs is a program for analyzing etcd server write ahead logs.
functional-tester
etcd-agent	etcd-agent is a daemon for controlling an etcd process via HTTP RPC.
client	Package client provides a client implementation to control an etcd-agent.
etcd-runner	etcd-runner is a program for testing etcd clientv3 features against a fault injected cluster.
command	Package command implements individual etcd-runner commands for the etcd-runner utility.
etcd-tester	etcd-tester is a single controller for all etcd-agents to manage an etcd cluster and simulate failures.
local-tester
bridge	Package main is the entry point for the local tester network bridge.
version	Package version implements etcd version parsing and contains latest version information.
wal	Package wal provides an implementation of a write ahead log that is used by etcd.
walpb	Package walpb is a generated protocol buffer package.
go-semver
semver	Semantic Versions http://semver.org
davecgh
go-spew
spew	Package spew implements a deep pretty printer for Go data structures to aid in debugging.
denisenkom
go-mssqldb	package mssql implements the TDS protocol used to connect to MS SQL Server (sqlserver) database servers.
batch	bach splits a single script containing multiple batches separated by a keyword into multiple scripts.
examples
bulk
simple
tsql
dgrijalva
jwt-go	Package jwt is a Go implementation of JSON Web Tokens: http://self-issued.info/docs/draft-jones-json-web-token.html See README.md for more info.
cmd
jwt	A useful example app.
request	Utility package for extracting JWT tokens from HTTP requests.
test
eapache
go-resiliency
batcher	Package batcher implements the batching resiliency pattern for Go.
breaker	Package breaker implements the circuit-breaker resiliency pattern for Go.
deadline	Package deadline implements the deadline (also known as "timeout") resiliency pattern for Go.
retrier	Package retrier implements the "retriable" resiliency pattern for Go.
semaphore	Package semaphore implements the semaphore resiliency pattern for Go.
go-xerial-snappy
queue	Package queue provides a fast, ring-buffer queue based on the version suggested by Dariusz Górecki.
go-kit
kit
auth
jwt
circuitbreaker	Package circuitbreaker implements the circuit breaker pattern.
endpoint	Package endpoint defines an abstraction for RPCs.
log	Package log provides a structured logger.
deprecated_levels
level	Package level implements leveled logging on top of package log.
term	Package term provides tools for logging to a terminal.
metrics	Package metrics provides a framework for application instrumentation.
discard	Package discard provides a no-op metrics backend.
dogstatsd	Package dogstatsd provides a DogStatsD backend for package metrics.
expvar	Package expvar provides expvar backends for metrics.
generic	Package generic implements generic versions of each of the metric types.
graphite	Package graphite provides a Graphite backend for metrics.
influx	Package influx provides an InfluxDB implementation for metrics.
multi	Package multi provides adapters that send observations to multiple metrics simultaneously.
pcp
prometheus	Package prometheus provides Prometheus implementations for metrics.
provider	Package provider provides a factory-like abstraction for metrics backends.
statsd	Package statsd provides a StatsD backend for package metrics.
teststat	Package teststat provides helpers for testing metrics backends.
ratelimit
sd	Package sd provides utilities related to service discovery.
cache
consul	Package consul provides subscriber and registrar implementations for Consul.
dnssrv	Package dnssrv provides a subscriber implementation for DNS SRV records.
etcd	Package etcd provides a Subscriber and Registrar implementation for etcd.
lb	Package lb implements the client-side load balancer pattern.
zk	Package zk provides subscriber and registrar implementations for ZooKeeper.
tracing	Package tracing provides helpers and bindings for distributed tracing.
opentracing	Package opentracing provides Go kit integration to the OpenTracing project.
transport	Package transport contains bindings to concrete transports.
grpc	Package grpc provides a gRPC binding for endpoints.
http	Package http provides a general purpose HTTP binding for endpoints.
httprp	Package httprp provides an HTTP reverse-proxy transport.
util
conn	Package conn provides utilities related to connections.
go-log
log	Package log provides a log interface
appengine
fmt
log
logrus
go-logfmt
logfmt	Package logfmt implements utilities to marshal and unmarshal data in the logfmt format.
go-redis
redis	Package redis implements a Redis client.
go-sql-driver
mysql	Package mysql provides a MySQL driver for Go's database/sql package The driver should be used via the database/sql package: import "database/sql" import _ "github.com/go-sql-driver/mysql" db, err := sql.Open("mysql", "user:password@/dbname") See https://github.com/go-sql-driver/mysql#usage for details
go-stack
stack	Package stack implements utilities to capture, manipulate, and format call stacks.
gocql
gocql	Package gocql implements a fast and robust Cassandra driver for the Go programming language.
gogo
protobuf
codec
gogoproto	Package gogoproto provides extensions for protocol buffers to achieve: - fast marshalling and unmarshalling.
gogoreplace
io
jsonpb	Package jsonpb provides marshaling and unmarshaling between protocol buffers and JSON.
jsonpb_test_proto	Package jsonpb is a generated protocol buffer package.
plugin
compare
defaultcheck	The defaultcheck plugin is used to check whether nullable is not used incorrectly.
description	The description (experimental) plugin generates a Description method for each message.
embedcheck	The embedcheck plugin is used to check whether embed is not used incorrectly.
enumstringer	The enumstringer (experimental) plugin generates a String method for each enum.
equal	The equal plugin generates an Equal and a VerboseEqual method for each message.
face	The face plugin generates a function will be generated which can convert a structure which satisfies an interface (face) to the specified structure.
gostring	The gostring plugin generates a GoString method for each message.
marshalto	The marshalto plugin generates a Marshal and MarshalTo method for each message.
oneofcheck	The oneofcheck plugin is used to check whether oneof is not used incorrectly.
populate	The populate plugin generates a NewPopulated function.
size	The size plugin generates a Size or ProtoSize method for each message.
stringer	The stringer plugin generates a String method for each message.
testgen	The testgen plugin generates Test and Benchmark functions for each message.
union	The onlyone plugin generates code for the onlyone extension.
unmarshal	The unmarshal plugin generates a Unmarshal method for each message.
proto	Package proto converts data structures to and from the wire format of protocol buffers.
proto3_proto	Package proto3_proto is a generated protocol buffer package.
protoc-gen-combo
protoc-gen-gofast
protoc-gen-gogo	protoc-gen-go is a plugin for the Google protocol buffer compiler to generate Go code.
descriptor	Package descriptor provides functions for obtaining protocol buffer descriptors for generated Go types.
generator	The code generator for the plugin for the Google protocol buffer compiler.
grpc	Package grpc outputs gRPC service descriptions in Go code.
plugin	Package plugin_go is a generated protocol buffer package.
protoc-gen-gogofast
protoc-gen-gogofaster
protoc-gen-gogoslick
protoc-gen-gogotypes
protoc-gen-gostring
protoc-min-version
sortkeys
test	Package test is a generated protocol buffer package.
asymetric-issue125	Package asym is a generated protocol buffer package.
casttype
combos
both	Package casttype is a generated protocol buffer package.
marshaler	Package casttype is a generated protocol buffer package.
neither	Package casttype is a generated protocol buffer package.
unmarshaler	Package casttype is a generated protocol buffer package.
unsafeboth	Package casttype is a generated protocol buffer package.
unsafemarshaler	Package casttype is a generated protocol buffer package.
unsafeunmarshaler	Package casttype is a generated protocol buffer package.
castvalue	Package castvalue is a generated protocol buffer package.
combos
both	Package castvalue is a generated protocol buffer package.
marshaler	Package castvalue is a generated protocol buffer package.
unmarshaler	Package castvalue is a generated protocol buffer package.
unsafeboth	Package castvalue is a generated protocol buffer package.
unsafemarshaler	Package castvalue is a generated protocol buffer package.
unsafeunmarshaler	Package castvalue is a generated protocol buffer package.
combos
both	Package test is a generated protocol buffer package.
marshaler	Package test is a generated protocol buffer package.
unmarshaler	Package test is a generated protocol buffer package.
unsafeboth	Package test is a generated protocol buffer package.
unsafemarshaler	Package test is a generated protocol buffer package.
unsafeunmarshaler	Package test is a generated protocol buffer package.
custom	Package custom contains custom types for test and example purposes.
custom-dash-type	Package custom contains custom types for test and example purposes.
custombytesnonstruct	Package custombytesnonstruct is a generated protocol buffer package.
dashfilename
data	Package data is a generated protocol buffer package.
defaultconflict
embedconflict
empty-issue70	Package empty is a generated protocol buffer package.
enumcustomname	Package enumcustomname is a generated protocol buffer package.
enumdecl	Package enumdecl is a generated protocol buffer package.
enumdecl_all	Package enumdeclall is a generated protocol buffer package.
enumprefix	Package enumprefix is a generated protocol buffer package.
enumstringer	Package enumstringer is a generated protocol buffer package.
example	Package test is a generated protocol buffer package.
filedotname	Package filedotname is a generated protocol buffer package.
fuzztests	Package fuzztests is a generated protocol buffer package.
group	Package group is a generated protocol buffer package.
importdedup	Package importdedup is a generated protocol buffer package.
subpkg	Package subpkg is a generated protocol buffer package.
indeximport-issue72	Package indeximport is a generated protocol buffer package.
index	Package index is a generated protocol buffer package.
issue260	Package issue260 is a generated protocol buffer package.
issue261	Package issue261 is a generated protocol buffer package.
issue262	Package timefail is a generated protocol buffer package.
issue34	Package issue34 is a generated protocol buffer package.
issue42order	Package issue42 is a generated protocol buffer package.
issue8	Package proto is a generated protocol buffer package.
mapsproto2
combos
both	Package proto2_maps is a generated protocol buffer package.
marshaler	Package proto2_maps is a generated protocol buffer package.
neither	Package proto2_maps is a generated protocol buffer package.
unmarshaler	Package proto2_maps is a generated protocol buffer package.
unsafeboth	Package proto2_maps is a generated protocol buffer package.
unsafemarshaler	Package proto2_maps is a generated protocol buffer package.
unsafeunmarshaler	Package proto2_maps is a generated protocol buffer package.
mixbench
moredefaults	Package moredefaults is a generated protocol buffer package.
nopackage	Package nopackage is a generated protocol buffer package.
oneof
combos
both	Package one is a generated protocol buffer package.
marshaler	Package one is a generated protocol buffer package.
neither	Package one is a generated protocol buffer package.
unmarshaler	Package one is a generated protocol buffer package.
unsafeboth	Package one is a generated protocol buffer package.
unsafemarshaler	Package one is a generated protocol buffer package.
unsafeunmarshaler	Package one is a generated protocol buffer package.
oneof3
combos
both	Package one is a generated protocol buffer package.
marshaler	Package one is a generated protocol buffer package.
neither	Package one is a generated protocol buffer package.
unmarshaler	Package one is a generated protocol buffer package.
unsafeboth	Package one is a generated protocol buffer package.
unsafemarshaler	Package one is a generated protocol buffer package.
unsafeunmarshaler	Package one is a generated protocol buffer package.
oneofembed	Package proto is a generated protocol buffer package.
packed	Package packed is a generated protocol buffer package.
proto3extension	Package proto3extension is a generated protocol buffer package.
protosize	Package protosize is a generated protocol buffer package.
required	Package required is a generated protocol buffer package.
sizeunderscore	Package sizeunderscore is a generated protocol buffer package.
stdtypes	Package stdtypes is a generated protocol buffer package.
tags	Package tags is a generated protocol buffer package.
theproto3
combos
both	Package theproto3 is a generated protocol buffer package.
marshaler	Package theproto3 is a generated protocol buffer package.
neither	Package theproto3 is a generated protocol buffer package.
unmarshaler	Package theproto3 is a generated protocol buffer package.
unsafeboth	Package theproto3 is a generated protocol buffer package.
unsafemarshaler	Package theproto3 is a generated protocol buffer package.
unsafeunmarshaler	Package theproto3 is a generated protocol buffer package.
typedecl	Package typedecl is a generated protocol buffer package.
typedecl_all	Package typedeclall is a generated protocol buffer package.
types
combos
both	Package types is a generated protocol buffer package.
marshaler	Package types is a generated protocol buffer package.
neither	Package types is a generated protocol buffer package.
unmarshaler	Package types is a generated protocol buffer package.
unsafeboth	Package types is a generated protocol buffer package.
unsafemarshaler	Package types is a generated protocol buffer package.
unsafeunmarshaler	Package types is a generated protocol buffer package.
unmarshalmerge	Package unmarshalmerge is a generated protocol buffer package.
unrecognized	Package unrecognized is a generated protocol buffer package.
unrecognizedgroup	Package unrecognizedgroup is a generated protocol buffer package.
types	Package types is a generated protocol buffer package.
vanity
command
test
fast	Package vanity is a generated protocol buffer package.
faster	Package vanity is a generated protocol buffer package.
slick	Package vanity is a generated protocol buffer package.
version
golang
glog	Package glog implements logging analogous to the Google-internal C++ INFO/ERROR/V setup.
lint	Package lint contains a linter for Go source code.
golint	golint lints the Go source files named on its command line.
mock
gomock	GoMock - a mock framework for Go.
mock_matcher
mockgen	MockGen generates mock implementations of Go interfaces.
model	Package model contains the data model necessary for generating mock implementations.
sample	An example package with an interface.
imp1
imp2
imp3
imp4
mock_user
protobuf
descriptor	Package descriptor provides functions for obtaining protocol buffer descriptors for generated Go types.
jsonpb	Package jsonpb provides marshaling and unmarshaling between protocol buffers and JSON.
jsonpb_test_proto	Package jsonpb is a generated protocol buffer package.
proto	Package proto converts data structures to and from the wire format of protocol buffers.
proto3_proto	Package proto3_proto is a generated protocol buffer package.
protoc-gen-go	protoc-gen-go is a plugin for the Google protocol buffer compiler to generate Go code.
descriptor	Package descriptor is a generated protocol buffer package.
generator	The code generator for the plugin for the Google protocol buffer compiler.
grpc	Package grpc outputs gRPC service descriptions in Go code.
plugin	Package plugin_go is a generated protocol buffer package.
ptypes	Package ptypes contains code for interacting with well-known types.
any	Package any is a generated protocol buffer package.
duration	Package duration is a generated protocol buffer package.
empty	Package empty is a generated protocol buffer package.
struct	Package structpb is a generated protocol buffer package.
timestamp	Package timestamp is a generated protocol buffer package.
wrappers	Package wrappers is a generated protocol buffer package.
snappy	Package snappy implements the snappy block-based compression format.
google
uuid	Package uuid generates and inspects UUIDs.
googleapis
gax-go	Package gax contains a set of modules which aid the development of APIs for clients and servers based on gRPC and Google API conventions.
gorilla
mux	Package mux implements a request router and dispatcher.
websocket	Package websocket implements the WebSocket protocol defined in RFC 6455.
examples
autobahn	Command server is a test server for the Autobahn WebSockets Test Suite.
chat
command
echo
filewatch
hailocab
go-hostpool	A Go package to intelligently and flexibly pool among multiple hosts from your Go application.
hashicorp
consul
acl
api	The /v1/operator/area endpoints are available only in Consul Enterprise and interact with its network area subsystem.
command
agent
mock
base
consul	The snapshot endpoint is a special non-RPC endpoint that supports streaming for taking and restoring snapshots for disaster recovery.
agent	Package agent provides a logical endpoint for Consul agents in the network.
prepared_query
servers	Package servers provides a Manager interface for Manager managed agent.Server objects.
state
structs
ipaddr
lib
logger
snapshot	The archive utilities manage the internal format of a snapshot, which is a tar file with the following contents: meta.json - JSON-encoded snapshot metadata from Raft state.bin - Encoded snapshot data from Raft SHA256SUMS - SHA-256 sums of the above two files The integrity information is automatically created and checked, and a failure there just looks like an error to the caller.
testrpc
testutil
retry	Package retry provides support for repeating operations in tests.
tlsutil
types
version
watch
influxdata
influxdb	Package influxdb is the root package of InfluxDB, the scalable datastore for metrics, events, and real-time analytics.
client	Package client implements a now-deprecated client for InfluxDB; use github.com/influxdata/influxdb/client/v2 instead.
v2	Package client (v2) is the current official Go client for InfluxDB.
cmd	Package cmd is the root package of the various command-line utilities for InfluxDB.
influx	The influx command is a CLI client to InfluxDB.
cli	Package cli contains the logic of the influx command line client.
influx_inspect	The influx_inspect command displays detailed information about InfluxDB data files.
dumptsm	Package dumptsm inspects low-level details about tsm1 files.
export	Package export exports TSM files into InfluxDB line protocol format.
help	Package help contains the help for the influx_inspect command.
report	Package report reports statistics about TSM files.
verify	Package verify verifies integrity of TSM files.
influx_stress	Command influx_stress is deprecated; use github.com/influxdata/influx-stress instead.
influx_tsm	Command influx_tsm converts b1 or bz1 shards (from InfluxDB releases earlier than v0.11) to the current tsm1 format.
b1	Package b1 reads data from b1 shards.
bz1	Package bz1 reads data from bz1 shards.
stats	Package stats contains statistics for converting non-TSM shards to TSM.
tsdb	Pacage tsdb abstracts the various shard types supported by the influx_tsm command.
influxd	Command influxd is the InfluxDB server.
backup	Package backup is the backup subcommand for the influxd command.
help	Package help is the help subcommand of the influxd command.
restore	Package restore is the restore subcommand for the influxd command, for restoring from a backup.
run	Package run is the run (default) subcommand for the influxd command.
coordinator	Package coordinator contains abstractions for writing points, executing statements, and accessing meta data.
importer
v8	Package v8 contains code for importing data from 0.8 instances of InfluxDB.
influxql	Package influxql implements a parser for the InfluxDB query language.
neldermead	Package neldermead is an implementation of the Nelder-Mead optimization method.
models	Package models implements basic objects used throughout the TICK stack.
monitor	Package monitor provides a service and associated functionality for InfluxDB to self-monitor internal statistics and diagnostics.
diagnostics	Package diagnostics provides the diagnostics type so that other packages can provide diagnostics without depending on the monitor package.
pkg
deep	Package deep provides a deep equality check for use in tests.
escape	Package escape contains utilities for escaping parts of InfluxQL and InfluxDB line protocol.
limiter	Package limiter provides concurrency limiters.
pool	Package pool provides pool structures to help reduce garbage collector pressure.
slices	Package slices contains functions to operate on slices treated as sets.
services
admin
statik
collectd	Package collectd provides a service for InfluxDB to ingest data via the collectd protocol.
test_client
continuous_querier	Package continuous_querier provides the continuous query service.
graphite	Package graphite provides a service for InfluxDB to ingest data via the graphite protocol.
httpd	Package httpd implements the HTTP service and REST API for InfluxDB.
meta	Package meta provides control over meta data for InfluxDB, such as controlling databases, retention policies, users, etc.
opentsdb	Package opentsdb provides a service for InfluxDB to ingest data via the opentsdb protocol.
precreator	Package precreator provides the shard precreation service.
retention	Package retention provides the retention policy enforcement service.
snapshotter	Package snapshotter provides the meta snapshot service.
subscriber	Package subscriber implements the subscriber service to forward incoming data to remote services.
udp	Package udp provides the UDP input service for InfluxDB.
stress
stress_test_server
v2
statement
stress_client
stressql
statement
tcp	Package tcp provides a simple multiplexer over TCP.
tests
urlgen
toml	Package toml adds support to marshal and unmarshal types not in the official TOML spec.
tsdb	Package tsdb implements a durable time series database.
engine	Package engine can be imported to initialize and register all available TSDB engines.
tsm1	Package tsm1 provides a TSDB in the Time Structured Merge tree format.
uuid	Package uuid provides functions to create time-based UUIDs.
jackc
pgx	Package pgx is a PostgreSQL database driver.
examples
chat
todo
url_shortener
stdlib	Package stdlib is the compatibility layer from pgx to database/sql.
jmoiron
sqlx	Package sqlx provides general purpose extensions to database/sql.
reflectx	Package reflectx implements extensions to the standard reflect lib suitable for implementing marshalling and unmarshalling packages.
types
juju
ratelimit	Package ratelimit provides an efficient token bucket implementation that can be used to limit the rate of arbitrary things.
klauspost
compress
flate	Package flate implements the DEFLATE compressed data format, described in RFC 1951.
gzip	Package gzip implements reading and writing of gzip format compressed files, as specified in RFC 1952.
snappy	Package snappy implements the snappy block-based compression format.
zip	Package zip provides support for reading and writing ZIP archives.
zlib	Package zlib implements reading and writing of zlib format compressed data, as specified in RFC 1950.
cpuid	Package cpuid provides information about the CPU running the current program.
private
crc32	Package crc32 implements the 32-bit cyclic redundancy check, or CRC-32, checksum.
lib
pq	Package pq is a pure Go Postgres driver for the database/sql package.
hstore
listen_example	Below you will find a self-contained Go program which uses the LISTEN / NOTIFY mechanism to avoid polling the database while waiting for more work to arrive.
oid	Package oid contains OID constants as defined by the Postgres server.
lightstep
lightstep-tracer-go
basictracer
cmd
benchmark
sendspan
collectorpb	Package collectorpb is a generated protocol buffer package.
examples
lightstep_thrift
lightsteppb	Package lightstep is a generated protocol buffer package.
thrift_0_9_2
lib
go
thrift
thrift_rpc
mattn
go-oci8
matttproud
golang_protobuf_extensions
ext	Package ext moved to a new location: github.com/matttproud/golang_protobuf_extensions/pbutil.
pbtest	Package pbtest is deleted for the time being, because upstream Protocol Buffer 3 may have rendered quick.Value-based blackbox generation impossible.
pbutil	Package pbutil provides record length-delimited Protocol Buffer streaming.
micro
cli	Package cli provides a minimal framework for creating and organizing command line Go applications.
altsrc
go-log
go-micro	Package micro is a pluggable RPC framework for microservices
broker	Package broker is an interface used for asynchronous messaging
codec
json
noop
http
mock
client	Package client is an interface for an RPC client
mock
rpc
cmd	Package cmd is an interface for parsing the command line
codec	Package codec is an interface for encoding messages
jsonrpc
protorpc	Package proto is a generated protocol buffer package.
errors	Package errors provides a way to return detailed information for an RPC request error.
metadata	Package metadata is a way of defining message headers
registry	Package registry is an interface for service discovery
consul
mdns
mock
selector	Package selector is a way to load balance service nodes
cache
server	Package server is an interface for a micro server
debug
proto	Package debug is a generated protocol buffer package.
mock
rpc
transport	Package is an interface for synchronous communication
codec
json
noop
http
mock
mdns
examples
client
service
misc
lib
addr
net
tls
miekg
dns	Package dns implements a full featured interface to the Domain Name System.
dnsutil	Package dnsutil contains higher-level methods useful with the dns package.
idn	Package idn implements encoding from and to punycode as speficied by RFC 3492.
mitchellh
hashstructure
onsi
ginkgo	Ginkgo is a BDD-style testing framework for Golang The godoc documentation describes Ginkgo's API.
config	Ginkgo accepts a number of configuration options.
extensions
table
ginkgo	The Ginkgo CLI The Ginkgo CLI is fully documented [here](http://onsi.github.io/ginkgo/#the_ginkgo_cli) You can also learn more by running: ginkgo help Here are some of the more commonly used commands: To install: go install github.com/onsi/ginkgo/ginkgo To run tests: ginkgo To run tests in all subdirectories: ginkgo -r To run tests in particular packages: ginkgo <flags> /path/to/package /path/to/another/package To pass arguments/flags to your tests: ginkgo <flags> <packages> -- <pass-throughs> To run tests in parallel ginkgo -p this will automatically detect the optimal number of nodes to use.
convert
interrupthandler
nodot
testrunner
testsuite
watch
integration
reporters	Ginkgo's Default Reporter A number of command line flags are available to tweak Ginkgo's default output.
stenographer
support
go-colorable
go-isatty	Package isatty implements interface to isatty
types
gomega	Gomega is the Ginkgo BDD-style testing framework's preferred matcher library.
format	Gomega's format package pretty-prints objects.
gbytes	Package gbytes provides a buffer that supports incrementally detecting input.
gexec	Package gexec provides support for testing external processes.
ghttp	Package ghttp supports testing HTTP clients by providing a test server (simply a thin wrapper around httptest's server) that supports registering multiple handlers.
protobuf	Package protobuf is a generated protocol buffer package.
gstruct
errors
matchers	Gomega matchers This package implements the Gomega matchers and does not typically need to be imported.
support
goraph
bipartitegraph
edge
node
util
types
opentracing
basictracer-go
events
examples
dapperish
wire	Package wire is a generated protocol buffer package.
opentracing-go
ext
log
mocktracer
openzipkin
zipkin-go-opentracing
events
flag
types
wire	Package wire is a generated protocol buffer package.
pborman
uuid	The uuid package generates and inspects UUIDs.
performancecopilot
speed	Package speed implements a golang client for the Performance Co-Pilot instrumentation API.
bytewriter	Package bytewriter implements writers that support concurrent writing within a fixed length block initially tried to use bytes.Buffer but the main restriction with that is that it does not allow the freedom to move around in the buffer.
examples
acme	A golang implementation of the acme factory examples from python and Java APIs The python implementation is in mmv.py in PCP core (https://github.com/performancecopilot/pcp/blob/master/src/python/pcp/mmv.py#L21-L70) The Java implementation is in examples in parfait core (https://github.com/performancecopilot/parfait/tree/master/examples/acme) To run the python version of the example that exits do go run examples/acme/main.go To run the java version of the example that runs forever, simply add a --forever flag go run examples/acme/main.go --forever
basic_histogram
http_counter
instance_string
runtime
simple
simple_string_metric
singleton_counter
singleton_string	this example showcases speeds metric inference from strings property
mmvdump	Package mmvdump implements a go port of the C mmvdump utility included in PCP Core https://github.com/performancecopilot/pcp/blob/master/src/pmdas/mmv/mmvdump.c It has been written for maximum portability with the C equivalent, without having to use cgo or any other ninja stuff the main difference is that the reader is separate from the cli with the reading primarily implemented in mmvdump.go while the cli is implemented in cmd/mmvdump the cli application is completely go gettable and outputs the same things, in mostly the same way as the C cli app, to try it out, ``` go get github.com/performancecopilot/speed/mmvdump/cmd/mmvdump ```
cmd
mmvdump
pierrec
lz4	Package lz4 implements reading and writing lz4 compressed data (a frame), as specified in http://fastcompression.blogspot.fr/2013/04/lz4-streaming-format-final.html, using an io.Reader (decompression) and io.Writer (compression).
fuzz
lz4c	Command line utility for the lz4 package.
xxHash
xxHash32	Package xxHash32 implements the very fast xxHash hashing algorithm (32 bits version).
xxHash64	Package xxHash64 implements the very fast xxHash hashing algorithm (64 bits version).
pkg
errors	Package errors provides simple error handling primitives.
prometheus
client_golang
api	Package api provides clients for the HTTP APIs.
prometheus
v1	Package v1 provides bindings to the Prometheus HTTP API v1: http://prometheus.io/docs/querying/api/
examples
random	A simple example exposing fictional RPC latencies with different types of random distributions (uniform, normal, and exponential) as Prometheus metrics.
simple	A minimal example of how to include Prometheus instrumentation.
prometheus	Package prometheus provides metrics primitives to instrument code for monitoring.
graphite	Package graphite provides a bridge to push Prometheus metrics to a Graphite server.
promhttp	Package promhttp provides tooling around HTTP servers and clients.
push	Package push provides functions to push metrics to a Pushgateway.
client_model
go	Package io_prometheus_client is a generated protocol buffer package.
common
config
expfmt	Package expfmt contains tools for reading and writing Prometheus metrics.
log
model	Package model contains common data structures that are shared across Prometheus components and libraries.
route
version
procfs	Package procfs provides functions to retrieve system, kernel and process metrics from the pseudo-filesystem proc.
bcache	Package bcache provides access to statistics exposed by the bcache (Linux block cache).
sysfs	Package sysfs provides functions to retrieve system and kernel metrics from the pseudo-filesystem sys.
xfs	Package xfs provides access to statistics exposed by the XFS filesystem.
rcrowley
go-metrics	Go port of Coda Hale's Metrics library <https://github.com/rcrowley/go-metrics> Coda Hale's original work: <https://github.com/codahale/metrics>
cmd
metrics-bench
metrics-example
never-read
exp	Hook go-metrics into expvar on any /debug/metrics request, load all vars from the registry into expvar, and execute regular expvar handler
librato
stathat	Metrics output to StatHat.
samuel
go-zookeeper
examples
zk	Package zk is a native Go client library for the ZooKeeper orchestration service.
shopspring
decimal	Package decimal implements an arbitrary precision fixed-point decimal.
sirupsen
logrus	Package logrus is a structured logger for Go, completely API compatible with the standard library logger.
examples
basic
hook
hooks
syslog
test	The Test package is used for testing logrus.
sony
gobreaker	Package gobreaker implements the Circuit Breaker pattern.
example
streadway
handy	Package handy organizes some useful http server handler filters or handlers for reuse.
accept	Package accept contains filters to reject requests without a specified Accept header with "406 Not Acceptable".
atomic	Package atomic implements atomic accessors for primitives
breaker	Package breaker implements a circuit breaker with configurable failure thresholds.
cors	Package cors contains filters to handle CORS related requests defined from http://www.w3.org/TR/cors/
encoding	Package encoding contains Content-Encoding related filters.
proxy	Package proxy contains a proxying HTTP transport.
redirect	Package redirect contains filters to handle HTTP and HTTPS redirects
report	Package report organizes textual reporting from the HTTP context.
retry	Package retry implements a retrying transport based on a combination of strategies.
rewrite	Package rewrite contains filters to handle HTTP rewrites
statsd	Package statsd collects and reports telemetry from http handlers.
stretchr
testify	Package testify is a set of packages that provide many tools for testifying that your code will behave as you intend.
assert	Package assert provides a set of comprehensive testing tools for use with the normal Go testing system.
http	Package http DEPRECATED USE net/http/httptest
mock	Package mock provides a system by which it is possible to mock your objects and verify calls are happening as expected.
require	Package require implements the same assertions as the `assert` package but stops test execution when a test fails.
suite	Package suite contains logic for creating testing suite structs and running the methods on those structs as tests.
tensorflow
tensorflow
tensorflow
go	Package tensorflow is a Go binding to TensorFlow.
genop	Command genop generates a Go source file with functions for TensorFlow ops.
op	Package op defines functions for adding TensorFlow operations to a Graph.
ugorji
go
codec	High Performance, Feature-Rich Idiomatic Go codec/encoding library for binc, msgpack, cbor, json.
codecgen	codecgen generates codec.Selfer implementations for a set of types.
valyala
bytebufferpool	Package bytebufferpool implements a pool of byte buffers with anti-fragmentation protection.
fasthttp	Package fasthttp provides fast HTTP server and client API.
examples
fileserver	Example static file server.
helloworldserver
expvarhandler	Package expvarhandler provides fasthttp-compatible request handler serving expvars.
fasthttpadaptor	Package fasthttpadaptor provides helper functions for converting net/http request handlers to fasthttp request handlers.
fasthttputil	Package fasthttputil provides utility functions for fasthttp.
reuseport	Package reuseport provides TCP net.Listener with SO_REUSEPORT support.
stackless	Package stackless provides functionality that may save stack space for high number of concurrently running goroutines.
go
ast	Package ast declares the types used to represent syntax trees for Go packages.
build	Package build gathers information about Go packages.
constant	Package constant implements Values representing untyped Go constants and their corresponding operations.
doc	Package doc extracts source code documentation from a Go AST.
format	Package format implements standard formatting of Go source.
importer	Package importer provides access to export data importers.
parser	Package parser implements a parser for Go source files.
printer	Package printer implements printing of AST nodes.
scanner	Package scanner implements a scanner for Go source text.
token	Package token defines constants representing the lexical tokens of the Go programming language and basic operations on tokens (printing, predicates).
types	Package types declares the data types and implements the algorithms for type-checking of Go packages.
go4.org
bytereplacer	Package bytereplacer provides a utility for replacing parts of byte slices.
cloud
cloudlaunch	Package cloudlaunch helps binaries run themselves on The Cloud, copying themselves to GCE.
google
gceutil	Package gceutil provides utility functions to help with instances on Google Compute Engine.
gcsutil	Package gcsutil provides tools for accessing Google Cloud Storage until they can be completely replaced by cloud.google.com/go/storage.
ctxutil	Package ctxutil contains golang.org/x/net/context related utilities.
errorutil	Package errorutil helps make better error messages.
fault	Package fault handles fault injection for testing.
go4test
cloudlaunch	The serve_on_cloud program deploys an HTTP server on Google Compute Engine, serving from Google Cloud Storage.
jsonconfig	Package jsonconfig defines a helper type for JSON objects to be used for configuration.
legal	Package legal provides in-process storage for compiled-in licenses.
lock	Package lock is a file locking library.
net
throttle	Package throttle provides a net.Listener that returns artificially-delayed connections for testing real-world connectivity.
oauthutil	Package oauthutil contains OAuth 2 related utilities.
osutil	Package osutil contains os level functions.
readerutil	Package readerutil provides and operates on io.Readers.
singlereader	package singlereader provides Open and Close operations, reusing existing file descriptors when possible.
reflectutil	Package reflectutil contains reflect utilities.
sort	Package sort provides primitives for sorting slices and user-defined collections.
strutil	Package strutil contains string and byte processing functions.
syncutil	Package syncutil provides various synchronization utilities.
singleflight	Package singleflight provides a duplicate function call suppression mechanism.
syncdebug	Package syncdebug contains facilities for debugging synchronization problems.
testing
functest	Package functest contains utilities to ease writing table-driven tests for pure functions and method.
types	Package types provides various common types.
wkfs	Package wkfs implements the pluggable "well-known filesystem" abstraction layer.
gcs	Package gcs registers a Google Cloud Storage filesystem at the well-known /gcs/ filesystem path if the current machine is running on Google Compute Engine.
writerutil	Package writerutil contains io.Writer types.
golang.org
x
crypto
acme	Package acme provides an implementation of the Automatic Certificate Management Environment (ACME) spec.
autocert	Package autocert provides automatic access to certificates from Let's Encrypt and any other ACME-based CA.
bcrypt	Package bcrypt implements Provos and Mazières's bcrypt adaptive hashing algorithm.
blake2b	Package blake2b implements the BLAKE2b hash algorithm as defined in RFC 7693.
blake2s	Package blake2s implements the BLAKE2s hash algorithm as defined in RFC 7693.
blowfish	Package blowfish implements Bruce Schneier's Blowfish encryption algorithm.
bn256	Package bn256 implements a particular bilinear group at the 128-bit security level.
cast5	Package cast5 implements CAST5, as defined in RFC 2144.
chacha20poly1305	Package chacha20poly1305 implements the ChaCha20-Poly1305 AEAD as specified in RFC 7539.
cryptobyte	Package cryptobyte implements building and parsing of byte strings for DER-encoded ASN.1 and TLS messages.
curve25519	Package curve25519 provides an implementation of scalar multiplication on the elliptic curve known as curve25519.
ed25519	Package ed25519 implements the Ed25519 signature algorithm.
hkdf	Package hkdf implements the HMAC-based Extract-and-Expand Key Derivation Function (HKDF) as defined in RFC 5869.
md4	Package md4 implements the MD4 hash algorithm as defined in RFC 1320.
nacl
box	Package box authenticates and encrypts messages using public-key cryptography.
secretbox	Package secretbox encrypts and authenticates small messages.
ocsp	Package ocsp parses OCSP responses as specified in RFC 2560.
openpgp	Package openpgp implements high level operations on OpenPGP messages.
armor	Package armor implements OpenPGP ASCII Armor, see RFC 4880.
clearsign	Package clearsign generates and processes OpenPGP, clear-signed data.
elgamal	Package elgamal implements ElGamal encryption, suitable for OpenPGP, as specified in "A Public-Key Cryptosystem and a Signature Scheme Based on Discrete Logarithms," IEEE Transactions on Information Theory, v.
errors	Package errors contains common error types for the OpenPGP packages.
packet	Package packet implements parsing and serialization of OpenPGP packets, as specified in RFC 4880.
s2k	Package s2k implements the various OpenPGP string-to-key transforms as specified in RFC 4800 section 3.7.1.
otr	Package otr implements the Off The Record protocol as specified in http://www.cypherpunks.ca/otr/Protocol-v2-3.1.0.html
pbkdf2	Package pbkdf2 implements the key derivation function PBKDF2 as defined in RFC 2898 / PKCS #5 v2.0.
pkcs12	Package pkcs12 implements some of PKCS#12.
poly1305	Package poly1305 implements Poly1305 one-time message authentication code as specified in http://cr.yp.to/mac/poly1305-20050329.pdf.
ripemd160	Package ripemd160 implements the RIPEMD-160 hash algorithm.
salsa20	Package salsa20 implements the Salsa20 stream cipher as specified in http://cr.yp.to/snuffle/spec.pdf.
salsa	Package salsa provides low-level access to functions in the Salsa family.
scrypt	Package scrypt implements the scrypt key derivation function as defined in Colin Percival's paper "Stronger Key Derivation via Sequential Memory-Hard Functions" (http://www.tarsnap.com/scrypt/scrypt.pdf).
sha3	Package sha3 implements the SHA-3 fixed-output-length hash functions and the SHAKE variable-output-length hash functions defined by FIPS-202.
ssh	Package ssh implements an SSH client and server.
agent	Package agent implements the ssh-agent protocol, and provides both a client and a server.
knownhosts	Package knownhosts implements a parser for the OpenSSH known_hosts host key database.
terminal	Package terminal provides support functions for dealing with terminals, as commonly found on UNIX systems.
test	This package contains integration tests for the golang.org/x/crypto/ssh package.
tea
twofish	Package twofish implements Bruce Schneier's Twofish encryption algorithm.
xtea	Package xtea implements XTEA encryption, as defined in Needham and Wheeler's 1997 technical report, "Tea extensions."
xts	Package xts implements the XTS cipher mode as specified in IEEE P1619/D16.
image
bmp	Package bmp implements a BMP image decoder and encoder.
cmd
webp-manual-test	Program webp-manual-test checks that the Go WEBP library's decodings match the C WEBP library's.
colornames	Package colornames provides named colors as defined in the SVG 1.1 spec.
draw	Package draw provides image composition functions.
example
font	Font is a basic example of using fonts.
font	Package font defines an interface for font faces, for drawing text on an image.
basicfont	Package basicfont provides fixed-size font faces.
gofont
gobold	Package gobold provides the "Go Bold" TrueType font from the Go font family.
gobolditalic	Package gobolditalic provides the "Go Bold Italic" TrueType font from the Go font family.
goitalic	Package goitalic provides the "Go Italic" TrueType font from the Go font family.
gomedium	Package gomedium provides the "Go Medium" TrueType font from the Go font family.
gomediumitalic	Package gomediumitalic provides the "Go Medium Italic" TrueType font from the Go font family.
gomono	Package gomono provides the "Go Mono" TrueType font from the Go font family.
gomonobold	Package gomonobold provides the "Go Mono Bold" TrueType font from the Go font family.
gomonobolditalic	Package gomonobolditalic provides the "Go Mono Bold Italic" TrueType font from the Go font family.
gomonoitalic	Package gomonoitalic provides the "Go Mono Italic" TrueType font from the Go font family.
goregular	Package goregular provides the "Go Regular" TrueType font from the Go font family.
gosmallcaps	Package gosmallcaps provides the "Go Smallcaps" TrueType font from the Go font family.
gosmallcapsitalic	Package gosmallcapsitalic provides the "Go Smallcaps Italic" TrueType font from the Go font family.
inconsolata	Package inconsolata provides pre-rendered bitmap versions of the Inconsolata font family.
plan9font	Package plan9font implements font faces for the Plan 9 font and subfont file formats.
sfnt	Package sfnt implements a decoder for SFNT font file formats, including TrueType and OpenType.
math
f32	Package f32 implements float32 vector and matrix types.
f64	Package f64 implements float64 vector and matrix types.
fixed	Package fixed implements fixed-point integer types.
riff	Package riff implements the Resource Interchange File Format, used by media formats such as AVI, WAVE and WEBP.
tiff	Package tiff implements a TIFF image decoder and encoder.
lzw	Package lzw implements the Lempel-Ziv-Welch compressed data format, described in T. A. Welch, ``A Technique for High-Performance Data Compression'', Computer, 17(6) (June 1984), pp 8-19.
vector	Package vector provides a rasterizer for 2-D vector graphics.
vp8	Package vp8 implements a decoder for the VP8 lossy image format.
vp8l	Package vp8l implements a decoder for the VP8L lossless image format.
webp	Package webp implements a decoder for WEBP images.
nycbcra	Package nycbcra provides non-alpha-premultiplied Y'CbCr-with-alpha image and color types.
net
bpf	Package bpf implements marshaling and unmarshaling of programs for the Berkeley Packet Filter virtual machine, and provides a Go implementation of the virtual machine.
context	Package context defines the Context type, which carries deadlines, cancelation signals, and other request-scoped values across API boundaries and between processes.
ctxhttp	Package ctxhttp provides helper functions for performing context-aware HTTP requests.
dict	Package dict implements the Dictionary Server Protocol as defined in RFC 2229.
dns
dnsmessage	Package dnsmessage provides a mostly RFC 1035 compliant implementation of DNS message packing and unpacking.
html	Package html implements an HTML5-compliant tokenizer and parser.
atom	Package atom provides integer codes (also known as atoms) for a fixed set of frequently occurring HTML strings: tag names and attribute keys such as "p" and "id".
charset	Package charset provides common text encodings for HTML documents.
http2	Package http2 implements the HTTP/2 protocol.
h2demo
h2i	The h2i command is an interactive HTTP/2 console.
hpack	Package hpack implements HPACK, a compression format for efficiently representing HTTP header fields in the context of HTTP/2.
icmp	Package icmp provides basic functions for the manipulation of messages used in the Internet Control Message Protocols, ICMPv4 and ICMPv6.
idna	Package idna implements IDNA2008 using the compatibility processing defined by UTS (Unicode Technical Standard) #46, which defines a standard to deal with the transition from IDNA2003.
ipv4	Package ipv4 implements IP-level socket options for the Internet Protocol version 4.
ipv6	Package ipv6 implements IP-level socket options for the Internet Protocol version 6.
lex
httplex	Package httplex contains rules around lexical matters of various HTTP-related specifications.
lif	Package lif provides basic functions for the manipulation of logical network interfaces and interface addresses on Solaris.
nettest	Package nettest provides utilities for network testing.
netutil	Package netutil provides network utility functions, complementing the more common ones in the net package.
proxy	Package proxy provides support for a variety of protocols to proxy network data.
publicsuffix	Package publicsuffix provides a public suffix list based on data from http://publicsuffix.org/.
route	Package route provides basic functions for the manipulation of packet routing facilities on BSD variants.
trace	Package trace implements tracing of requests and long-lived objects.
webdav	Package webdav provides a WebDAV server implementation.
websocket	Package websocket implements a client and server for the WebSocket protocol as specified in RFC 6455.
xsrftoken	Package xsrftoken provides methods for generating and validating secure XSRF tokens.
oauth2	Package oauth2 provides support for making OAuth2 authorized and authenticated HTTP requests.
amazon	Package amazon provides constants for using OAuth2 to access Amazon.
bitbucket	Package bitbucket provides constants for using OAuth2 to access Bitbucket.
clientcredentials	Package clientcredentials implements the OAuth2.0 "client credentials" token flow, also known as the "two-legged OAuth 2.0".
facebook	Package facebook provides constants for using OAuth2 to access Facebook.
fitbit	Package fitbit provides constants for using OAuth2 to access the Fitbit API.
foursquare	Package foursquare provides constants for using OAuth2 to access Foursquare.
github	Package github provides constants for using OAuth2 to access Github.
google	Package google provides support for making OAuth2 authorized and authenticated HTTP requests to Google APIs.
heroku	Package heroku provides constants for using OAuth2 to access Heroku.
hipchat	Package hipchat provides constants for using OAuth2 to access HipChat.
jws	Package jws provides a partial implementation of JSON Web Signature encoding and decoding.
jwt	Package jwt implements the OAuth 2.0 JSON Web Token flow, commonly known as "two-legged OAuth 2.0".
linkedin	Package linkedin provides constants for using OAuth2 to access LinkedIn.
mediamath	Package mediamath provides constants for using OAuth2 to access MediaMath.
microsoft	Package microsoft provides constants for using OAuth2 to access Windows Live ID.
odnoklassniki	Package odnoklassniki provides constants for using OAuth2 to access Odnoklassniki.
paypal	Package paypal provides constants for using OAuth2 to access PayPal.
slack	Package slack provides constants for using OAuth2 to access Slack.
uber	Package uber provides constants for using OAuth2 to access Uber.
vk	Package vk provides constants for using OAuth2 to access VK.com.
yandex	Package yandex provides constants for using OAuth2 to access Yandex APIs.
sync
errgroup	Package errgroup provides synchronization, error propagation, and Context cancelation for groups of goroutines working on subtasks of a common task.
semaphore	Package semaphore provides a weighted semaphore implementation.
singleflight	Package singleflight provides a duplicate function call suppression mechanism.
syncmap	Package syncmap provides a concurrent map implementation.
sys
plan9	Package plan9 contains an interface to the low-level operating system primitives.
unix	Package unix contains an interface to the low-level operating system primitives.
linux
windows	Package windows contains an interface to the low-level operating system primitives.
registry	Package registry provides access to the Windows registry.
svc	Package svc provides everything required to build Windows service.
debug	Package debug provides facilities to execute svc.Handler on console.
eventlog	Package eventlog implements access to Windows event log.
mgr	Package mgr can be used to manage Windows service programs.
text	text is a repository of text-related packages related to internationalization (i18n) and localization (l10n), such as character encodings, text transformations, and locale-specific text handling.
cases	Package cases provides general and language-specific case mappers.
cmd
gotext	gotext is a tool for managing text in Go source code.
collate	Package collate contains types for comparing and sorting Unicode strings according to a given collation order.
build
currency	Package currency contains currency-related functionality.
encoding	Package encoding defines an interface for character encodings, such as Shift JIS and Windows 1252, that can convert to and from UTF-8.
charmap	Package charmap provides simple character encodings such as IBM Code Page 437 and Windows 1252.
htmlindex	Package htmlindex maps character set encoding names to Encodings as recommended by the W3C for use in HTML 5.
ianaindex	Package ianaindex maps names to Encodings as specified by the IANA registry.
japanese	Package japanese provides Japanese encodings such as EUC-JP and Shift JIS.
korean	Package korean provides Korean encodings such as EUC-KR.
simplifiedchinese	Package simplifiedchinese provides Simplified Chinese encodings such as GBK.
traditionalchinese	Package traditionalchinese provides Traditional Chinese encodings such as Big5.
unicode	Package unicode provides Unicode encodings such as UTF-16.
utf32	Package utf32 provides the UTF-32 Unicode encoding.
feature
plural	Package plural provides utilities for handling linguistic plurals in text.
language	Package language implements BCP 47 language tags and related functionality.
display	Package display provides display names for languages, scripts and regions in a requested language.
message	Package message implements formatted I/O for localized strings with functions analogous to the fmt's print functions.
catalog	Package catalog defines collections of translated format strings.
runes	Package runes provide transforms for UTF-8 encoded text.
search	Package search provides language-specific search and string matching.
secure	secure is a repository of text security related packages.
bidirule	Package bidirule implements the Bidi Rule defined by RFC 5893.
precis	Package precis contains types and functions for the preparation, enforcement, and comparison of internationalized strings ("PRECIS") as defined in RFC 7564.
transform	Package transform provides reader and writer wrappers that transform the bytes passing through as well as various transformations.
unicode	unicode holds packages with implementations of Unicode standards that are mostly used as building blocks for other packages in golang.org/x/text, layout engines, or are otherwise more low-level in nature.
bidi	Package bidi contains functionality for bidirectional text support.
cldr	Package cldr provides a parser for LDML and related XML formats.
norm	Package norm contains types and functions for normalizing Unicode strings.
rangetable	Package rangetable provides utilities for creating and inspecting unicode.RangeTables.
runenames	Package runenames provides rune names from the Unicode Character Database.
width	Package width provides functionality for handling different widths in text.
tools
benchmark
parse	Package parse provides support for parsing benchmark results as generated by 'go test -bench'.
blog	Package blog implements a web server for articles written in present format.
atom	Package atom defines XML data structures for an Atom feed.
cmd
benchcmp	The benchcmp command displays performance changes between benchmarks.
bundle	Bundle creates a single-source-file version of a source package suitable for inclusion in a particular target package.
callgraph	callgraph: a tool for reporting the call graph of a Go program.
cover	Cover is a program for analyzing the coverage profiles generated by 'go test -coverprofile=cover.out'.
digraph	The digraph command performs queries over unlabelled directed graphs represented in text form.
eg	The eg command performs example-based refactoring.
fiximports	The fiximports command fixes import declarations to use the canonical import path for packages that have an "import comment" as defined by https://golang.org/s/go14customimport.
godex	The godex command prints (dumps) exported information of packages or selected package objects.
godoc	Godoc extracts and generates documentation for Go programs.
goimports	Command goimports updates your Go import lines, adding missing ones and removing unreferenced ones.
gomvpkg	The gomvpkg command moves go packages, updating import declarations.
gorename	The gorename command performs precise type-safe renaming of identifiers in Go source code.
gotype	The gotype command, like the front-end of a Go compiler, parses and type-checks a single Go package.
goyacc	Goyacc is a version of yacc for Go.
guru	guru: a tool for answering questions about Go source code.
serial	Package serial defines the guru's schema for -json output.
heapview	heapview is a tool for viewing Go heap dumps.
html2article	This program takes an HTML file and outputs a corresponding article file in present format.
present	Present displays slide presentations and articles.
ssadump	ssadump: a tool for displaying and interpreting the SSA form of Go programs.
stress	The stress utility is intended for catching of episodic failures.
stringer	Stringer is a tool to automate the creation of methods that satisfy the fmt.Stringer interface.
tip	Command tip is the tip.golang.org server, serving the latest HEAD straight from the Git oven.
toolstash	Toolstash provides a way to save, run, and restore a known good copy of the Go toolchain and to compare the object files generated by two toolchains.
container
intsets	Package intsets provides Sparse, a compact and fast representation for sparse sets of int values.
cover	Package cover provides support for parsing coverage profiles generated by "go test -coverprofile=cover.out".
go
ast
astutil	Package astutil contains common utilities for working with the Go AST.
buildutil	Package buildutil provides utilities related to the go/build package in the standard library.
callgraph	Package callgraph defines the call graph and various algorithms and utilities to operate on it.
cha	Package cha computes the call graph of a Go program using the Class Hierarchy Analysis (CHA) algorithm.
rta	This package provides Rapid Type Analysis (RTA) for Go, a fast algorithm for call graph construction and discovery of reachable code (and hence dead code) and runtime types.
static	Package static computes the call graph of a Go program containing only static call edges.
gccgoexportdata	Package gccgoexportdata provides functions for reading export data files containing type information produced by the gccgo compiler.
gcexportdata	Package gcexportdata provides functions for locating, reading, and writing export data files containing type information produced by the gc compiler.
gcimporter15	Package gcimporter15 provides various functions for reading gc-generated object files that can be used to implement the Importer interface defined by the Go 1.5 standard library package.
loader	Package loader loads a complete Go program from source code, parsing and type-checking the initial packages plus their transitive closure of dependencies.
pointer	Package pointer implements Andersen's analysis, an inclusion-based pointer analysis algorithm first described in (Andersen, 1994).
ssa	Package ssa defines a representation of the elements of Go programs (packages, types, functions, variables and constants) using a static single-assignment (SSA) form intermediate representation (IR) for the bodies of functions.
interp	Package ssa/interp defines an interpreter for the SSA representation of Go programs.
ssautil
types
typeutil	Package typeutil defines various utilities for types, such as Map, a mapping from types.Type to interface{} values.
vcs
godoc	Package godoc is a work-in-progress (2013-07-17) package to begin splitting up the godoc binary into multiple pieces.
analysis	Package analysis performs type and pointer analysis and generates mark-up for the Go source view.
dl	Package dl implements a simple downloads frontend server.
proxy	Package proxy proxies requests to the sandbox compiler service and the playground share handler.
redirect	Package redirect provides hooks to register HTTP handlers that redirect old godoc paths to their new equivalents and assist in accessing the issue tracker, wiki, code review system, etc.
short	Package short implements a simple URL shortener, serving an administrative interface at /s and shortened urls from /s/key.
static	Package static exports a map of static file content that supports the godoc user interface.
util	Package util contains utility types and functions for godoc.
vfs	Package vfs defines types for abstract file system access and provides an implementation accessing the file system of the underlying OS.
gatefs	Package gatefs provides an implementation of the FileSystem interface that wraps another FileSystem and limits its concurrency.
httpfs	Package httpfs implements http.FileSystem using a godoc vfs.FileSystem.
mapfs	Package mapfs file provides an implementation of the FileSystem interface based on the contents of a map[string]string.
zipfs	Package zipfs file provides an implementation of the FileSystem interface based on the contents of a .zip file.
imports	Package imports implements a Go pretty-printer (like package "go/format") that also adds or removes import statements as necessary.
playground	Package playground registers HTTP handlers at "/compile" and "/share" that proxy requests to the golang.org playground service.
socket	Package socket implements an WebSocket-based playground backend.
present	The present file format Present files have the following format.
refactor
eg	Package eg implements the example-based refactoring tool whose command-line is defined in golang.org/x/tools/cmd/eg.
importgraph	Package importgraph computes the forward and reverse import dependency graphs for all packages in a Go workspace.
rename	Package rename contains the implementation of the 'gorename' command whose main function is in golang.org/x/tools/cmd/gorename.
satisfy	Package satisfy inspects the type-checked ASTs of Go packages and reports the set of discovered type constraints of the form (lhs, rhs Type) where lhs is a non-trivial interface, rhs satisfies this interface, and this fact is necessary for the package to be well-typed.
tour
content
basics
concurrency
flowcontrol
methods
moretypes
welcome
gotour
pic
reader
solutions
tree
wc
google.golang.org
api
acceleratedmobilepageurl
v1	Package acceleratedmobilepageurl provides access to the Accelerated Mobile Pages (AMP) URL API.
adexchangebuyer
v1.2	Package adexchangebuyer provides access to the Ad Exchange Buyer API.
v1.3	Package adexchangebuyer provides access to the Ad Exchange Buyer API.
v1.4	Package adexchangebuyer provides access to the Ad Exchange Buyer API.
adexchangebuyer2
v2beta1	Package adexchangebuyer2 provides access to the Ad Exchange Buyer API II.
adexchangeseller
v1	Package adexchangeseller provides access to the Ad Exchange Seller API.
v1.1	Package adexchangeseller provides access to the Ad Exchange Seller API.
v2.0	Package adexchangeseller provides access to the Ad Exchange Seller API.
adexperiencereport
v1	Package adexperiencereport provides access to the Google Ad Experience Report API.
admin
datatransfer
v1	Package admin provides access to the Admin Data Transfer API.
directory
v1	Package admin provides access to the Admin Directory API.
reports
v1	Package admin provides access to the Admin Reports API.
adsense
v1.3	Package adsense provides access to the AdSense Management API.
v1.4	Package adsense provides access to the AdSense Management API.
adsensehost
v4.1	Package adsensehost provides access to the AdSense Host API.
analytics
v2.4	Package analytics provides access to the Google Analytics API.
v3	Package analytics provides access to the Google Analytics API.
analyticsreporting
v4	Package analyticsreporting provides access to the Google Analytics Reporting API.
androidenterprise
v1	Package androidenterprise provides access to the Google Play EMM API.
androidpublisher
v1	Package androidpublisher provides access to the Google Play Developer API.
v1.1	Package androidpublisher provides access to the Google Play Developer API.
v2	Package androidpublisher provides access to the Google Play Developer API.
appengine
v1	Package appengine provides access to the Google App Engine Admin API.
v1alpha	Package appengine provides access to the Google App Engine Admin API.
v1beta	Package appengine provides access to the Google App Engine Admin API.
v1beta4	Package appengine provides access to the Google App Engine Admin API.
v1beta5	Package appengine provides access to the Google App Engine Admin API.
appsactivity
v1	Package appsactivity provides access to the G Suite Activity API.
appstate
v1	Package appstate provides access to the Google App State API.
bigquery
v2	Package bigquery provides access to the BigQuery API.
bigquerydatatransfer
v1	Package bigquerydatatransfer provides access to the BigQuery Data Transfer Service API.
blogger
v2	Package blogger provides access to the Blogger API.
v3	Package blogger provides access to the Blogger API.
books
v1	Package books provides access to the Books API.
calendar
v3	Package calendar provides access to the Calendar API.
civicinfo
v2	Package civicinfo provides access to the Google Civic Information API.
classroom
v1	Package classroom provides access to the Google Classroom API.
cloudbilling
v1	Package cloudbilling provides access to the Google Cloud Billing API.
cloudbuild
v1	Package cloudbuild provides access to the Google Cloud Container Builder API.
clouddebugger
v2	Package clouddebugger provides access to the Stackdriver Debugger API.
clouderrorreporting
v1beta1	Package clouderrorreporting provides access to the Stackdriver Error Reporting API.
cloudfunctions
v1	Package cloudfunctions provides access to the Google Cloud Functions API.
v1beta2	Package cloudfunctions provides access to the Google Cloud Functions API.
cloudkms
v1	Package cloudkms provides access to the Google Cloud Key Management Service (KMS) API.
cloudmonitoring
v2beta2	Package cloudmonitoring provides access to the Cloud Monitoring API.
cloudresourcemanager
v1	Package cloudresourcemanager provides access to the Google Cloud Resource Manager API.
v1beta1	Package cloudresourcemanager provides access to the Google Cloud Resource Manager API.
cloudtrace
v1	Package cloudtrace provides access to the Stackdriver Trace API.
clouduseraccounts
v0.alpha	Package clouduseraccounts provides access to the Cloud User Accounts API.
v0.beta	Package clouduseraccounts provides access to the Cloud User Accounts API.
vm_alpha	Package clouduseraccounts provides access to the Cloud User Accounts API.
vm_beta	Package clouduseraccounts provides access to the Cloud User Accounts API.
compute
v0.alpha	Package compute provides access to the Compute Engine API.
v0.beta	Package compute provides access to the Compute Engine API.
v1	Package compute provides access to the Compute Engine API.
consumersurveys
v2	Package consumersurveys provides access to the Consumer Surveys API.
container
v1	Package container provides access to the Google Container Engine API.
content
v2	Package content provides access to the Content API for Shopping.
v2sandbox	Package content provides access to the Content API for Shopping.
customsearch
v1	Package customsearch provides access to the CustomSearch API.
dataflow
v1b3	Package dataflow provides access to the Google Dataflow API.
dataproc
v1	Package dataproc provides access to the Google Cloud Dataproc API.
v1alpha1	Package dataproc provides access to the Google Cloud Dataproc API.
v1beta1	Package dataproc provides access to the Google Cloud Dataproc API.
datastore
v1	Package datastore provides access to the Google Cloud Datastore API.
v1beta3	Package datastore provides access to the Google Cloud Datastore API.
deploymentmanager
v0.alpha	Package deploymentmanager provides access to the Google Cloud Deployment Manager Alpha API.
v2	Package deploymentmanager provides access to the Google Cloud Deployment Manager API.
v2beta	Package deploymentmanager provides access to the Google Cloud Deployment Manager API V2Beta Methods.
dfareporting
v2.7	Package dfareporting provides access to the DCM/DFA Reporting And Trafficking API.
v2.8	Package dfareporting provides access to the DCM/DFA Reporting And Trafficking API.
discovery
v1	Package discovery provides access to the APIs Discovery Service.
dlp
v2beta1	Package dlp provides access to the DLP API.
dns
v1	Package dns provides access to the Google Cloud DNS API.
v2beta1	Package dns provides access to the Google Cloud DNS API.
doubleclickbidmanager
v1	Package doubleclickbidmanager provides access to the DoubleClick Bid Manager API.
doubleclicksearch
v2	Package doubleclicksearch provides access to the DoubleClick Search API.
drive
v2	Package drive provides access to the Drive API.
v3	Package drive provides access to the Drive API.
examples
firebasedynamiclinks
v1	Package firebasedynamiclinks provides access to the Firebase Dynamic Links API.
firebaserules
v1	Package firebaserules provides access to the Firebase Rules API.
fitness
v1	Package fitness provides access to the Fitness.
fusiontables
v1	Package fusiontables provides access to the Fusion Tables API.
v2	Package fusiontables provides access to the Fusion Tables API.
games
v1	Package games provides access to the Google Play Game Services API.
gamesconfiguration
v1configuration	Package gamesconfiguration provides access to the Google Play Game Services Publishing API.
gamesmanagement
v1management	Package gamesmanagement provides access to the Google Play Game Services Management API.
genomics
v1	Package genomics provides access to the Genomics API.
v1alpha2	Package genomics provides access to the Genomics API.
gensupport	Package gensupport is an internal implementation detail used by code generated by the google-api-go-generator tool.
gmail
v1	Package gmail provides access to the Gmail API.
google-api-go-generator
googleapi	Package googleapi contains the common code shared by all Google API libraries.
transport	Package transport contains HTTP transports used to make authenticated API requests.
groupsmigration
v1	Package groupsmigration provides access to the Groups Migration API.
groupssettings
v1	Package groupssettings provides access to the Groups Settings API.
iam
v1	Package iam provides access to the Google Identity and Access Management (IAM) API.
identitytoolkit
v3	Package identitytoolkit provides access to the Google Identity Toolkit API.
iterator	Package iterator provides support for standard Google API iterators.
testing	Package testing provides support functions for testing iterators conforming to the standard pattern.
kgsearch
v1	Package kgsearch provides access to the Knowledge Graph Search API.
language
v1	Package language provides access to the Google Cloud Natural Language API.
v1beta1	Package language provides access to the Google Cloud Natural Language API.
v1beta2	Package language provides access to the Google Cloud Natural Language API.
licensing
v1	Package licensing provides access to the Enterprise License Manager API.
logging
v2	Package logging provides access to the Stackdriver Logging API.
v2beta1	Package logging provides access to the Stackdriver Logging API.
manufacturers
v1	Package manufacturers provides access to the Manufacturer Center API.
mirror
v1	Package mirror provides access to the Google Mirror API.
ml
v1	Package ml provides access to the Google Cloud Machine Learning Engine.
v1beta1	Package ml provides access to the Google Cloud Machine Learning Engine.
monitoring
v3	Package monitoring provides access to the Stackdriver Monitoring API.
oauth2
v1	Package oauth2 provides access to the Google OAuth2 API.
v2	Package oauth2 provides access to the Google OAuth2 API.
option	Package option contains options for Google API clients.
pagespeedonline
v1	Package pagespeedonline provides access to the PageSpeed Insights API.
v2	Package pagespeedonline provides access to the PageSpeed Insights API.
partners
v2	Package partners provides access to the Google Partners API.
people
v1	Package people provides access to the Google People API.
playmoviespartner
v1	Package playmoviespartner provides access to the Google Play Movies Partner API.
plus
v1	Package plus provides access to the Google+ API.
plusdomains
v1	Package plusdomains provides access to the Google+ Domains API.
prediction
v1.2	Package prediction provides access to the Prediction API.
v1.3	Package prediction provides access to the Prediction API.
v1.4	Package prediction provides access to the Prediction API.
v1.5	Package prediction provides access to the Prediction API.
v1.6	Package prediction provides access to the Prediction API.
proximitybeacon
v1beta1	Package proximitybeacon provides access to the Google Proximity Beacon API.
pubsub
v1	Package pubsub provides access to the Google Cloud Pub/Sub API.
v1beta1a	Package pubsub provides access to the Google Cloud Pub/Sub API.
v1beta2	Package pubsub provides access to the Google Cloud Pub/Sub API.
qpxexpress
v1	Package qpxexpress provides access to the QPX Express API.
replicapool
v1beta1	Package replicapool provides access to the Replica Pool API.
v1beta2	Package replicapool provides access to the Google Compute Engine Instance Group Manager API.
replicapoolupdater
v1beta1	Package replicapoolupdater provides access to the Google Compute Engine Instance Group Updater API.
reseller
v1	Package reseller provides access to the Enterprise Apps Reseller API.
resourceviews
v1beta1	Package resourceviews provides access to the Resource Views API.
v1beta2	Package resourceviews provides access to the Google Compute Engine Instance Groups API.
runtimeconfig
v1	Package runtimeconfig provides access to the Google Cloud Runtime Configuration API.
v1beta1	Package runtimeconfig provides access to the Google Cloud Runtime Configuration API.
safebrowsing
v4	Package safebrowsing provides access to the Google Safe Browsing API.
script
v1	Package script provides access to the Google Apps Script Execution API.
searchconsole
v1	Package searchconsole provides access to the Google Search Console URL Testing Tools API.
servicecontrol
v1	Package servicecontrol provides access to the Google Service Control API.
servicemanagement
v1	Package servicemanagement provides access to the Google Service Management API.
serviceuser
v1	Package serviceuser provides access to the Google Service User API.
sheets
v4	Package sheets provides access to the Google Sheets API.
siteverification
v1	Package siteverification provides access to the Google Site Verification API.
slides
v1	Package slides provides access to the Google Slides API.
sourcerepo
v1	Package sourcerepo provides access to the Cloud Source Repositories API.
spanner
v1	Package spanner provides access to the Cloud Spanner API.
spectrum
v1explorer	Package spectrum provides access to the Google Spectrum Database API.
speech
v1	Package speech provides access to the Google Cloud Speech API.
v1beta1	Package speech provides access to the Google Cloud Speech API.
sqladmin
v1beta3	Package sqladmin provides access to the Cloud SQL Administration API.
v1beta4	Package sqladmin provides access to the Cloud SQL Administration API.
storage
v1	Package storage provides access to the Cloud Storage JSON API.
v1beta1	Package storage provides access to the Cloud Storage JSON API.
v1beta2	Package storage provides access to the Cloud Storage JSON API.
storagetransfer
v1	Package storagetransfer provides access to the Google Storage Transfer API.
support
bundler	Package bundler supports bundling (batching) of items.
surveys
v2	Package surveys provides access to the Surveys API.
tagmanager
v1	Package tagmanager provides access to the Tag Manager API.
v2	Package tagmanager provides access to the Tag Manager API.
taskqueue
v1beta1	Package taskqueue provides access to the TaskQueue API.
v1beta2	Package taskqueue provides access to the TaskQueue API.
tasks
v1	Package tasks provides access to the Tasks API.
toolresults
v1beta3	Package toolresults provides access to the Cloud Tool Results API.
v1beta3firstparty	Package toolresults provides access to the Cloud Tool Results firstparty API.
tracing
v2	Package tracing provides access to the Google Tracing API.
translate
v2	Package translate provides access to the Google Cloud Translation API.
transport	Package transport supports network connections to HTTP and GRPC servers.
bytestream	Package bytestream provides a client for any service that exposes a ByteStream API.
urlshortener
v1	Package urlshortener provides access to the URL Shortener API.
videointelligence
v1beta1	Package videointelligence provides access to the Google Cloud Video Intelligence API.
vision
v1	Package vision provides access to the Google Cloud Vision API.
webfonts
v1	Package webfonts provides access to the Google Fonts Developer API.
webmasters
v3	Package webmasters provides access to the Search Console API.
youtube
v3	Package youtube provides access to the YouTube Data API.
youtubeanalytics
v1	Package youtubeanalytics provides access to the YouTube Analytics API.
v1beta1	Package youtubeanalytics provides access to the YouTube Analytics API.
youtubereporting
v1	Package youtubereporting provides access to the YouTube Reporting API.
appengine	Package appengine provides basic functionality for Google App Engine.
aetest	Package aetest provides an API for running dev_appserver for use in tests.
blobstore	Package blobstore provides a client for App Engine's persistent blob storage service.
capability	Package capability exposes information about outages and scheduled downtime for specific API capabilities.
channel	Package channel implements the server side of App Engine's Channel API.
cloudsql	Package cloudsql exposes access to Google Cloud SQL databases.
cmd
aebundler	Program aebundler turns a Go app into a fully self-contained tar file.
aedeploy	Program aedeploy assists with deploying App Engine "flexible environment" Go apps to production.
aefix
datastore	Package datastore provides a client for App Engine's datastore service.
delay	Package delay provides a way to execute code outside the scope of a user request by using the taskqueue API.
file	Package file provides helper functions for using Google Cloud Storage.
image	Package image provides image services.
log	Package log provides the means of querying an application's logs from within an App Engine application.
mail	Package mail provides the means of sending email from an App Engine application.
memcache	Package memcache provides a client for App Engine's distributed in-memory key-value store for small chunks of arbitrary data.
module	Package module provides functions for interacting with modules.
remote_api	Package remote_api implements the /_ah/remote_api endpoint.
runtime	Package runtime exposes information about the resource usage of the application.
search	Package search provides a client for App Engine's search service.
socket	Package socket provides outbound network sockets.
taskqueue	Package taskqueue provides a client for App Engine's taskqueue service.
urlfetch	Package urlfetch provides an http.RoundTripper implementation for fetching URLs via App Engine's urlfetch service.
user	Package user provides a client for App Engine's user authentication service.
xmpp	Package xmpp provides the means to send and receive instant messages to and from users of XMPP-compatible services.
genproto	Regen.go regenerates the genproto repository.
googleapis
api	Package api is a generated protocol buffer package.
annotations	Package annotations is a generated protocol buffer package.
configchange	Package configchange is a generated protocol buffer package.
distribution	Package distribution is a generated protocol buffer package.
httpbody	Package httpbody is a generated protocol buffer package.
label	Package label is a generated protocol buffer package.
metric	Package metric is a generated protocol buffer package.
monitoredres	Package monitoredres is a generated protocol buffer package.
serviceconfig	Package serviceconfig is a generated protocol buffer package.
servicecontrol
v1	Package servicecontrol is a generated protocol buffer package.
servicemanagement
v1	Package servicemanagement is a generated protocol buffer package.
appengine
legacy	Package legacy is a generated protocol buffer package.
logging
v1	Package logging is a generated protocol buffer package.
v1	Package appengine is a generated protocol buffer package.
assistant
embedded
v1alpha1	Package embedded is a generated protocol buffer package.
bigtable
admin
table
v1	Package table is a generated protocol buffer package.
v2	Package admin is a generated protocol buffer package.
v1	Package bigtable is a generated protocol buffer package.
v2	Package bigtable is a generated protocol buffer package.
bytestream	Package bytestream is a generated protocol buffer package.
cloud
audit	Package audit is a generated protocol buffer package.
billing
v1	Package billing is a generated protocol buffer package.
dataproc
v1	Package dataproc is a generated protocol buffer package.
functions
v1beta2	Package functions is a generated protocol buffer package.
language
v1	Package language is a generated protocol buffer package.
v1beta1	Package language is a generated protocol buffer package.
v1beta2	Package language is a generated protocol buffer package.
ml
v1	Package ml is a generated protocol buffer package.
v1beta1	Package ml is a generated protocol buffer package.
runtimeconfig
v1beta1	Package runtimeconfig is a generated protocol buffer package.
speech
v1	Package speech is a generated protocol buffer package.
v1beta1	Package speech is a generated protocol buffer package.
support
common	Package common is a generated protocol buffer package.
v1alpha1	Package support is a generated protocol buffer package.
videointelligence
v1beta1	Package videointelligence is a generated protocol buffer package.
vision
v1	Package vision is a generated protocol buffer package.
container
v1	Package container is a generated protocol buffer package.
datastore
v1	Package datastore is a generated protocol buffer package.
v1beta3	Package datastore is a generated protocol buffer package.
devtools
build
v1	Package build is a generated protocol buffer package.
cloudbuild
v1	Package cloudbuild is a generated protocol buffer package.
clouddebugger
v2	Package clouddebugger is a generated protocol buffer package.
clouderrorreporting
v1beta1	Package clouderrorreporting is a generated protocol buffer package.
cloudprofiler
v2	Package cloudprofiler is a generated protocol buffer package.
cloudtrace
v1	Package cloudtrace is a generated protocol buffer package.
source
v1	Package source is a generated protocol buffer package.
sourcerepo
v1	Package sourcerepo is a generated protocol buffer package.
example
library
v1	Package library is a generated protocol buffer package.
genomics
v1	Package genomics is a generated protocol buffer package.
v1alpha2	Package genomics is a generated protocol buffer package.
iam
admin
v1	Package admin is a generated protocol buffer package.
v1	Package iam is a generated protocol buffer package.
logging
type	Package ltype is a generated protocol buffer package.
v2	Package logging is a generated protocol buffer package.
longrunning	Package longrunning is a generated protocol buffer package.
monitoring
v3	Package monitoring is a generated protocol buffer package.
privacy
dlp
v2beta1	Package dlp is a generated protocol buffer package.
pubsub
v1	Package pubsub is a generated protocol buffer package.
v1beta2	Package pubsub is a generated protocol buffer package.
rpc
code	Package code is a generated protocol buffer package.
errdetails	Package errdetails is a generated protocol buffer package.
status	Package status is a generated protocol buffer package.
spanner
admin
database
v1	Package database is a generated protocol buffer package.
instance
v1	Package instance is a generated protocol buffer package.
v1	Package spanner is a generated protocol buffer package.
storagetransfer
v1	Package storagetransfer is a generated protocol buffer package.
tracing
v1	Package tracing is a generated protocol buffer package.
type
color	Package color is a generated protocol buffer package.
date	Package date is a generated protocol buffer package.
dayofweek	Package dayofweek is a generated protocol buffer package.
latlng	Package latlng is a generated protocol buffer package.
money	Package money is a generated protocol buffer package.
postaladdress	Package postaladdress is a generated protocol buffer package.
timeofday	Package timeofday is a generated protocol buffer package.
watcher
v1	Package watcher is a generated protocol buffer package.
protobuf
api	Package api is a generated protocol buffer package.
field_mask	Package field_mask is a generated protocol buffer package.
ptype	Package ptype is a generated protocol buffer package.
source_context	Package source_context is a generated protocol buffer package.
grpc	Package grpc implements an RPC system called gRPC.
benchmark	Package benchmark implements the building blocks to setup end-to-end gRPC benchmarks.
client
grpc_testing	Package grpc_testing is a generated protocol buffer package.
server
stats
worker
codes	Package codes defines the canonical error codes used by gRPC.
credentials	Package credentials implements various credentials supported by gRPC library, which encapsulate all the state needed by a client to authenticate with a server and make various assertions, e.g., about the client's identity, role, or whether it is authorized to make a particular call.
oauth	Package oauth implements gRPC credentials using OAuth.
examples
helloworld
greeter_client
greeter_server
helloworld	Package helloworld is a generated protocol buffer package.
mock_helloworld
route_guide
client	Package main implements a simple gRPC client that demonstrates how to use gRPC-Go libraries to perform unary, client streaming, server streaming and full duplex RPCs.
mock_routeguide
routeguide	Package routeguide is a generated protocol buffer package.
server	Package main implements a simple gRPC server that demonstrates how to use gRPC-Go libraries to perform unary, client streaming, server streaming and full duplex RPCs.
grpclb
grpc_lb_v1	Package grpc_lb_v1 is a generated protocol buffer package.
grpclog	Package grpclog defines logging for grpc.
glogger	Package glogger defines glog-based logging for grpc.
health	Package health provides some utility functions to health-check a server.
grpc_health_v1	Package grpc_health_v1 is a generated protocol buffer package.
interop
client
grpc_testing	Package grpc_testing is a generated protocol buffer package.
http2
server
keepalive	Package keepalive defines configurable parameters for point-to-point healthcheck.
metadata	Package metadata define the structure of the metadata supported by gRPC library.
naming	Package naming defines the naming API and related data structures for gRPC.
peer	Package peer defines various peer information associated with RPCs and corresponding utils.
reflection	Package reflection implements server reflection service.
grpc_reflection_v1alpha	Package grpc_reflection_v1alpha is a generated protocol buffer package.
grpc_testing	Package grpc_testing is a generated protocol buffer package.
stats	Package stats is for collecting and reporting various network and RPC stats.
grpc_testing	Package grpc_testing is a generated protocol buffer package.
status	Package status implements errors returned by gRPC.
stress
client	client starts an interop client to do stress test and a metrics server to report qps.
grpc_testing	Package grpc_testing is a generated protocol buffer package.
metrics_client
tap	Package tap defines the function handles which are executed on the transport layer of gRPC-Go and related information.
test
codec_perf	Package codec_perf is a generated protocol buffer package.
grpc_testing	Package grpc_testing is a generated protocol buffer package.
transport	Package transport defines and implements message oriented communication channel to complete various transactions (e.g., an RPC).
gopkg.in
asn1-ber.v1
check.v1	Package check is a rich testing extension for Go's testing package.
inf.v0	Package inf (type inf.Dec) implements "infinite-precision" decimal arithmetic.
ldap.v2	Package ldap provides basic LDAP v3 functionality.
mgo.v2	Package mgo offers a rich MongoDB driver for Go.
bson	Package bson is an implementation of the BSON specification for Go: http://bsonspec.org It was created as part of the mgo MongoDB driver for Go, but is standalone and may be used on its own without the driver.
dbtest
txn	The txn package implements support for multi-document transactions.
rana
ora.v4	Package ora implements an Oracle database driver.
date	Package date implements encoding of 7 byte Oracle DATE storage formats.
examples
bench
oci8
ora
connect
conntest	Package main in conntest represents a connection testing program.
csvdump	Package main in csvdump represents a cursor->csv dumper Copyright 2013 Tamás Gulácsi Licensed under the Apache License, Version 2.0 (the "License"); you may not use this file except in compliance with the License.
csvload	Package main in csvload is a csv -> table loader.
glg
lg
lg15
num
tstlg
yaml.v2	Package yaml implements YAML support for the Go language.
hash	Package hash provides interfaces for hash functions.
adler32	Package adler32 implements the Adler-32 checksum.
crc32	Package crc32 implements the 32-bit cyclic redundancy check, or CRC-32, checksum.
crc64	Package crc64 implements the 64-bit cyclic redundancy check, or CRC-64, checksum.
fnv	Package fnv implements FNV-1 and FNV-1a, non-cryptographic hash functions created by Glenn Fowler, Landon Curt Noll, and Phong Vo.
hello
html	Package html provides functions for escaping and unescaping HTML text.
template	Package template (html/template) implements data-driven templates for generating HTML output safe against code injection.
image	Package image implements a basic 2-D image library.
color	Package color implements a basic color library.
palette	Package palette provides standard color palettes.
draw	Package draw provides image composition functions.
gif	Package gif implements a GIF image decoder and encoder.
jpeg	Package jpeg implements a JPEG image decoder and encoder.
png	Package png implements a PNG image decoder and encoder.
index
suffixarray	Package suffixarray implements substring search in logarithmic time using an in-memory suffix array.
io	Package io provides basic interfaces to I/O primitives.
ioutil	Package ioutil implements some I/O utility functions.
log	Package log implements a simple logging package.
syslog	Package syslog provides a simple interface to the system log service.
math	Package math provides basic constants and mathematical functions.
big	Package big implements arbitrary-precision arithmetic (big numbers).
cmplx	Package cmplx provides basic constants and mathematical functions for complex numbers.
rand	Package rand implements pseudo-random number generators.
mime	Package mime implements parts of the MIME spec.
multipart	Package multipart implements MIME multipart parsing, as defined in RFC 2046.
quotedprintable	Package quotedprintable implements quoted-printable encoding as specified by RFC 2045.
net	Package net provides a portable interface for network I/O, including TCP/IP, UDP, domain name resolution, and Unix domain sockets.
http	Package http provides HTTP client and server implementations.
cgi	Package cgi implements CGI (Common Gateway Interface) as specified in RFC 3875.
cookiejar	Package cookiejar implements an in-memory RFC 6265-compliant http.CookieJar.
fcgi	Package fcgi implements the FastCGI protocol.
httptest	Package httptest provides utilities for HTTP testing.
httptrace	Package httptrace provides mechanisms to trace the events within HTTP client requests.
httputil	Package httputil provides HTTP utility functions, complementing the more common ones in the net/http package.
pprof	Package pprof serves via its HTTP server runtime profiling data in the format expected by the pprof visualization tool.
mail	Package mail implements parsing of mail messages.
rpc	Package rpc provides access to the exported methods of an object across a network or other I/O connection.
jsonrpc	Package jsonrpc implements a JSON-RPC ClientCodec and ServerCodec for the rpc package.
smtp	Package smtp implements the Simple Mail Transfer Protocol as defined in RFC 5321.
textproto	Package textproto implements generic support for text-based request/response protocols in the style of HTTP, NNTP, and SMTP.
url	Package url parses URLs and implements query escaping.
os	Package os provides a platform-independent interface to operating system functionality.
exec	Package exec runs external commands.
signal	Package signal implements access to incoming signals.
user	Package user allows user account lookups by name or id.
path	Package path implements utility routines for manipulating slash-separated paths.
filepath	Package filepath implements utility routines for manipulating filename paths in a way compatible with the target operating system-defined file paths.
plugin	Package plugin implements loading and symbol resolution of Go plugins.
reflect	Package reflect implements run-time reflection, allowing a program to manipulate objects with arbitrary types.
regexp	Package regexp implements regular expression search.
syntax	Package syntax parses regular expressions into parse trees and compiles parse trees into programs.
runtime	Package runtime contains operations that interact with Go's runtime system, such as functions to control goroutines.
cgo	Package cgo contains runtime support for code generated by the cgo tool.
debug	Package debug contains facilities for programs to debug themselves while they are running.
msan
pprof	Package pprof writes runtime profiling data in the format expected by the pprof visualization tool.
race	Package race implements data race detection logic.
trace	Go execution tracer.
sort	Package sort provides primitives for sorting slices and user-defined collections.
sourcegraph.com
sourcegraph
appdash	Package appdash provides a Go app performance tracing suite.
cmd
appdash	Command appdash runs the Appdash web UI from the command-line.
examples
cmd
webapp	webapp: a standalone example Negroni / Gorilla based webapp.
webapp-opentracing	webapp: a standalone example Negroni / Gorilla based webapp.
httptrace	Package httptrace implements support for tracing HTTP applications.
opentracing	Package opentracing provides an Appdash implementation of the OpenTracing API.
sqltrace	Package sqltrace implements utility types for tracing SQL queries.
traceapp	Package traceapp implements the Appdash web UI.
tmpl	Package tmpl contains template data used by Appdash.
strconv	Package strconv implements conversions to and from string representations of basic data types.
strings	Package strings implements simple functions to manipulate UTF-8 encoded strings.
sync	Package sync provides basic synchronization primitives such as mutual exclusion locks.
atomic	Package atomic provides low-level atomic memory primitives useful for implementing synchronization algorithms.
syscall	Package syscall contains an interface to the low-level operating system primitives.
testing	Package testing provides support for automated testing of Go packages.
iotest	Package iotest implements Readers and Writers useful mainly for testing.
quick	Package quick implements utility functions to help with black box testing.
text
scanner	Package scanner provides a scanner and tokenizer for UTF-8-encoded text.
tabwriter	Package tabwriter implements a write filter (tabwriter.Writer) that translates tabbed columns in input into properly aligned text.
template	Package template implements data-driven templates for generating textual output.
parse	Package parse builds parse trees for templates as defined by text/template and html/template.
time	Package time provides functionality for measuring and displaying time.
unicode	Package unicode provides data and functions to test some properties of Unicode code points.
utf16	Package utf16 implements encoding and decoding of UTF-16 sequences.
utf8	Package utf8 implements functions and constants to support text encoded in UTF-8.
unsafe	Package unsafe contains operations that step around the type safety of Go programs.

Go sub-repository packages included in ActiveGo

These packages, installed with ActiveGo, are part of the Go Project but outside the main Go tree. They are developed under looser compatibility requirements than the Go core.

crypto — additional cryptography packages.
image — additional imaging packages.
net — additional networking packages.
oauth2 — packages for making OAuth2 authorized and authenticated HTTP requests
sys — packages for making system calls.
text — packages for working with text.
tools — godoc, goimports, gorename, and other tools.
tour — tour.golang.org's implementation

Community

These services can help you find additional Open Source packages provided by the community that are not already included in ActiveGo.

GoDoc - a package index and search engine.
Go Search - a code search engine.