...
Package service
Overview ▹
Index ▹
Subdirectories
| Name | Synopsis |
|---|---|
| .. | |
| acm | Package acm provides the client and types for making API requests to AWS Certificate Manager. |
| acmiface | Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code. |
| apigateway | Package apigateway provides the client and types for making API requests to Amazon API Gateway. |
| apigatewayiface | Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code. |
| applicationautoscaling | Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling. |
| applicationautoscalingiface | Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code. |
| applicationdiscoveryservice | Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service. |
| applicationdiscoveryserviceiface | Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code. |
| appstream | Package appstream provides the client and types for making API requests to Amazon AppStream. |
| appstreamiface | Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code. |
| athena | Package athena provides the client and types for making API requests to Amazon Athena. |
| athenaiface | Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code. |
| autoscaling | Package autoscaling provides the client and types for making API requests to Auto Scaling. |
| autoscalingiface | Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code. |
| batch | Package batch provides the client and types for making API requests to AWS Batch. |
| batchiface | Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code. |
| budgets | Package budgets provides the client and types for making API requests to AWS Budgets. |
| budgetsiface | Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code. |
| clouddirectory | Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory. |
| clouddirectoryiface | Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code. |
| cloudformation | Package cloudformation provides the client and types for making API requests to AWS CloudFormation. |
| cloudformationiface | Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code. |
| cloudfront | Package cloudfront provides the client and types for making API requests to Amazon CloudFront. |
| cloudfrontiface | Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code. |
| sign | Package sign provides utilities to generate signed URLs for Amazon CloudFront. |
| cloudhsm | Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM. |
| cloudhsmiface | Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code. |
| cloudsearch | Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch. |
| cloudsearchiface | Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code. |
| cloudsearchdomain | Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain. |
| cloudsearchdomainiface | Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code. |
| cloudtrail | Package cloudtrail provides the client and types for making API requests to AWS CloudTrail. |
| cloudtrailiface | Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code. |
| cloudwatch | Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch. |
| cloudwatchiface | Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code. |
| cloudwatchevents | Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events. |
| cloudwatcheventsiface | Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code. |
| cloudwatchlogs | Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs. |
| cloudwatchlogsiface | Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code. |
| codebuild | Package codebuild provides the client and types for making API requests to AWS CodeBuild. |
| codebuildiface | Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code. |
| codecommit | Package codecommit provides the client and types for making API requests to AWS CodeCommit. |
| codecommitiface | Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code. |
| codedeploy | Package codedeploy provides the client and types for making API requests to AWS CodeDeploy. |
| codedeployiface | Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code. |
| codepipeline | Package codepipeline provides the client and types for making API requests to AWS CodePipeline. |
| codepipelineiface | Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code. |
| codestar | Package codestar provides the client and types for making API requests to AWS CodeStar. |
| codestariface | Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code. |
| cognitoidentity | Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity. |
| cognitoidentityiface | Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code. |
| cognitoidentityprovider | Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider. |
| cognitoidentityprovideriface | Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code. |
| cognitosync | Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync. |
| cognitosynciface | Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code. |
| configservice | Package configservice provides the client and types for making API requests to AWS Config. |
| configserviceiface | Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code. |
| costandusagereportservice | Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service. |
| costandusagereportserviceiface | Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code. |
| databasemigrationservice | Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service. |
| databasemigrationserviceiface | Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code. |
| datapipeline | Package datapipeline provides the client and types for making API requests to AWS Data Pipeline. |
| datapipelineiface | Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code. |
| devicefarm | Package devicefarm provides the client and types for making API requests to AWS Device Farm. |
| devicefarmiface | Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code. |
| directconnect | Package directconnect provides the client and types for making API requests to AWS Direct Connect. |
| directconnectiface | Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code. |
| directoryservice | Package directoryservice provides the client and types for making API requests to AWS Directory Service. |
| directoryserviceiface | Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code. |
| dynamodb | Package dynamodb provides the client and types for making API requests to Amazon DynamoDB. |
| dynamodbattribute | Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues. |
| dynamodbiface | Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code. |
| dynamodbstreams | Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams. |
| dynamodbstreamsiface | Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code. |
| ec2 | Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud. |
| ec2iface | Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code. |
| ecr | Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry. |
| ecriface | Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code. |
| ecs | Package ecs provides the client and types for making API requests to Amazon EC2 Container Service. |
| ecsiface | Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code. |
| efs | Package efs provides the client and types for making API requests to Amazon Elastic File System. |
| efsiface | Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code. |
| elasticache | Package elasticache provides the client and types for making API requests to Amazon ElastiCache. |
| elasticacheiface | Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code. |
| elasticbeanstalk | Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk. |
| elasticbeanstalkiface | Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code. |
| elasticsearchservice | Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service. |
| elasticsearchserviceiface | Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code. |
| elastictranscoder | Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder. |
| elastictranscoderiface | Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code. |
| elb | Package elb provides the client and types for making API requests to Elastic Load Balancing. |
| elbiface | Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
| elbv2 | Package elbv2 provides the client and types for making API requests to Elastic Load Balancing. |
| elbv2iface | Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
| emr | Package emr provides the client and types for making API requests to Amazon Elastic MapReduce. |
| emriface | Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code. |
| firehose | Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose. |
| firehoseiface | Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code. |
| gamelift | Package gamelift provides the client and types for making API requests to Amazon GameLift. |
| gameliftiface | Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code. |
| glacier | Package glacier provides the client and types for making API requests to Amazon Glacier. |
| glacieriface | Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code. |
| greengrass | Package greengrass provides the client and types for making API requests to AWS Greengrass. |
| greengrassiface | Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code. |
| health | Package health provides the client and types for making API requests to AWS Health APIs and Notifications. |
| healthiface | Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code. |
| iam | Package iam provides the client and types for making API requests to AWS Identity and Access Management. |
| iamiface | Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code. |
| inspector | Package inspector provides the client and types for making API requests to Amazon Inspector. |
| inspectoriface | Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code. |
| iot | Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected things (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud. |
| iotiface | Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code. |
| iotdataplane | Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane. |
| iotdataplaneiface | Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code. |
| kinesis | Package kinesis provides the client and types for making API requests to Amazon Kinesis. |
| kinesisiface | Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code. |
| kinesisanalytics | Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics. |
| kinesisanalyticsiface | Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. |
| kms | Package kms provides the client and types for making API requests to AWS Key Management Service. |
| kmsiface | Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code. |
| lambda | Package lambda provides the client and types for making API requests to AWS Lambda. |
| lambdaiface | Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code. |
| lexmodelbuildingservice | Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service. |
| lexmodelbuildingserviceiface | Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code. |
| lexruntimeservice | Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service. |
| lexruntimeserviceiface | Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code. |
| lightsail | Package lightsail provides the client and types for making API requests to Amazon Lightsail. |
| lightsailiface | Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code. |
| machinelearning | Package machinelearning provides the client and types for making API requests to Amazon Machine Learning. |
| machinelearningiface | Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code. |
| marketplacecommerceanalytics | Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics. |
| marketplacecommerceanalyticsiface | Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code. |
| marketplaceentitlementservice | Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service. |
| marketplaceentitlementserviceiface | Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code. |
| marketplacemetering | Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering. |
| marketplacemeteringiface | Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code. |
| mobileanalytics | Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics. |
| mobileanalyticsiface | Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code. |
| mturk | Package mturk provides the client and types for making API requests to Amazon Mechanical Turk. |
| mturkiface | Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code. |
| opsworks | Package opsworks provides the client and types for making API requests to AWS OpsWorks. |
| opsworksiface | Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code. |
| opsworkscm | Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate. |
| opsworkscmiface | Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code. |
| organizations | Package organizations provides the client and types for making API requests to AWS Organizations. |
| organizationsiface | Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code. |
| pinpoint | Package pinpoint provides the client and types for making API requests to Amazon Pinpoint. |
| pinpointiface | Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code. |
| polly | Package polly provides the client and types for making API requests to Amazon Polly. |
| pollyiface | Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code. |
| rds | Package rds provides the client and types for making API requests to Amazon Relational Database Service. |
| rdsiface | Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code. |
| rdsutils | |
| redshift | Package redshift provides the client and types for making API requests to Amazon Redshift. |
| redshiftiface | Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code. |
| rekognition | Package rekognition provides the client and types for making API requests to Amazon Rekognition. |
| rekognitioniface | Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code. |
| resourcegroupstaggingapi | Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API. |
| resourcegroupstaggingapiiface | Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code. |
| route53 | Package route53 provides the client and types for making API requests to Amazon Route 53. |
| route53iface | Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code. |
| route53domains | Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains. |
| route53domainsiface | Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code. |
| s3 | Package s3 provides the client and types for making API requests to Amazon Simple Storage Service. |
| s3crypto | Package s3crypto provides encryption to S3 using KMS and AES GCM. |
| s3iface | Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code. |
| s3manager | Package s3manager provides utilities to upload and download objects from S3 concurrently. |
| s3manageriface | Package s3manageriface provides an interface for the s3manager package |
| servicecatalog | Package servicecatalog provides the client and types for making API requests to AWS Service Catalog. |
| servicecatalogiface | Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code. |
| ses | Package ses provides the client and types for making API requests to Amazon Simple Email Service. |
| sesiface | Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code. |
| sfn | Package sfn provides the client and types for making API requests to AWS Step Functions. |
| sfniface | Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code. |
| shield | Package shield provides the client and types for making API requests to AWS Shield. |
| shieldiface | Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code. |
| simpledb | Package simpledb provides the client and types for making API requests to Amazon SimpleDB. |
| simpledbiface | Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code. |
| sms | Package sms provides the client and types for making API requests to AWS Server Migration Service. |
| smsiface | Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code. |
| snowball | Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball. |
| snowballiface | Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code. |
| sns | Package sns provides the client and types for making API requests to Amazon Simple Notification Service. |
| snsiface | Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code. |
| sqs | Package sqs provides the client and types for making API requests to Amazon Simple Queue Service. |
| sqsiface | Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code. |
| ssm | Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM). |
| ssmiface | Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code. |
| storagegateway | Package storagegateway provides the client and types for making API requests to AWS Storage Gateway. |
| storagegatewayiface | Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code. |
| sts | Package sts provides the client and types for making API requests to AWS Security Token Service. |
| stsiface | Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code. |
| support | Package support provides the client and types for making API requests to AWS Support. |
| supportiface | Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code. |
| swf | Package swf provides the client and types for making API requests to Amazon Simple Workflow Service. |
| swfiface | Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code. |
| waf | Package waf provides the client and types for making API requests to AWS WAF. |
| wafiface | Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code. |
| wafregional | Package wafregional provides the client and types for making API requests to AWS WAF Regional. |
| wafregionaliface | Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code. |
| workdocs | Package workdocs provides the client and types for making API requests to Amazon WorkDocs. |
| workdocsiface | Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code. |
| workspaces | Package workspaces provides the client and types for making API requests to Amazon WorkSpaces. |
| workspacesiface | Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code. |
| xray | Package xray provides the client and types for making API requests to AWS X-Ray. |
| xrayiface | Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code. |
ActiveGo 1.8