/src/github.com - ActiveState ActiveGo 1.8
...

Directory /src/github.com

Name Synopsis
..
Shopify
sarama Package sarama is a pure Go client library for dealing with Apache Kafka (versions 0.8 and later).
examples
http_server
mocks Package mocks provides mocks that can be used for testing applications that use Sarama.
tools
kafka-console-consumer
kafka-console-partitionconsumer
kafka-console-producer
toxiproxy
cli
client Package Toxiproxy provides a client wrapper around the Toxiproxy HTTP API for testing the resiliency of Go applications.
cmd
stream
testhelper
testing
toxics
VividCortex
gohistogram Package gohistogram contains implementations of weighted and exponential histograms.
afex
hystrix-go
hystrix Package hystrix is a latency and fault tolerance library designed to isolate points of access to remote systems, services and 3rd party libraries, stop cascading failure and enable resilience in complex distributed systems where failure is inevitable.
metric_collector
rolling
loadtest
service Package main implements an http server which executes a hystrix command each request and sends metrics to a statsd instance to aid performance testing.
plugins Plugins allows users to operate on statistics recorded for each circuit operation.
apache
thrift
lib
go
test
tests
thrift
test
go
src
bin
stress
testclient
testserver
common
tutorial
go
src
aws
aws-sdk-go Package sdk is the official AWS SDK for the Go programming language.
aws Package aws provides the core SDK's utilities and shared types.
awserr Package awserr represents API error interface accessors for the SDK.
awsutil
client
metadata
corehandlers
credentials Package credentials provides credential retrieval and management The Credentials is the primary method of getting access to and managing credentials Values.
ec2rolecreds
endpointcreds Package endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint.
stscreds Package stscreds are credential Providers to retrieve STS AWS credentials.
defaults Package defaults is a collection of helpers to retrieve the SDK's default configuration and handlers.
ec2metadata Package ec2metadata provides the client for making API calls to the EC2 Metadata service.
endpoints Package endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions.
request
session Package session provides configuration for the SDK's service clients.
signer
v4 Package v4 implements signing for AWS V4 signer Provides request signing for request that need to be signed with AWS V4 Signatures.
awsmigrate
awsmigrate-renamer
gen
rename
awstesting
cmd
bucket_cleanup
integration Package integration performs initialization and validation for integration tests.
customizations
s3
s3crypto Package s3crypto provides gucumber integration tests support.
s3manager
smoke Package smoke contains shared step definitions that are used across integration tests
acm Package acm provides gucumber integration tests support.
apigateway Package apigateway provides gucumber integration tests support.
applicationdiscoveryservice Package applicationdiscoveryservice provides gucumber integration tests support.
autoscaling Package autoscaling provides gucumber integration tests support.
cloudformation Package cloudformation provides gucumber integration tests support.
cloudfront Package cloudfront provides gucumber integration tests support.
cloudhsm Package cloudhsm provides gucumber integration tests support.
cloudsearch Package cloudsearch provides gucumber integration tests support.
cloudtrail Package cloudtrail provides gucumber integration tests support.
cloudwatch Package cloudwatch provides gucumber integration tests support.
cloudwatchlogs Package cloudwatchlogs provides gucumber integration tests support.
codecommit Package codecommit provides gucumber integration tests support.
codedeploy Package codedeploy provides gucumber integration tests support.
codepipeline Package codepipeline provides gucumber integration tests support.
cognitoidentity Package cognitoidentity provides gucumber integration tests support.
cognitosync Package cognitosync provides gucumber integration tests support.
configservice Package configservice provides gucumber integration tests support.
datapipeline Package datapipeline provides gucumber integration tests support.
devicefarm Package devicefarm provides gucumber integration tests support.
directconnect Package directconnect provides gucumber integration tests support.
directoryservice Package directoryservice provides gucumber integration tests support.
dynamodb Package dynamodb provides gucumber integration tests support.
dynamodbstreams Package dynamodbstreams provides gucumber integration tests support.
ec2 Package ec2 provides gucumber integration tests support.
ecs Package ecs provides gucumber integration tests support.
efs Package efs provides gucumber integration tests support.
elasticache Package elasticache provides gucumber integration tests support.
elasticbeanstalk Package elasticbeanstalk provides gucumber integration tests support.
elasticloadbalancing Package elasticloadbalancing provides gucumber integration tests support.
elastictranscoder Package elastictranscoder provides gucumber integration tests support.
emr Package emr provides gucumber integration tests support.
es Package es provides gucumber integration tests support.
glacier Package glacier provides gucumber integration tests support.
iam Package iam provides gucumber integration tests support.
iotdataplane Package iotdataplane provides gucumber integration tests support.
kinesis Package kinesis provides gucumber integration tests support.
kms Package kms provides gucumber integration tests support.
lambda Package lambda provides gucumber integration tests support.
machinelearning Package machinelearning provides gucumber integration tests support.
opsworks Package opsworks provides gucumber integration tests support.
rds Package rds provides gucumber integration tests support.
redshift Package redshift provides gucumber integration tests support.
route53 Package route53 provides gucumber integration tests support.
route53domains Package route53domains provides gucumber integration tests support.
ses Package ses provides gucumber integration tests support.
simpledb Package simpledb provides gucumber integration tests support.
sns Package sns provides gucumber integration tests support.
sqs Package sqs provides gucumber integration tests support.
ssm Package ssm provides gucumber integration tests support.
storagegateway Package storagegateway provides gucumber integration tests support.
sts Package sts provides gucumber integration tests support.
support Package support provides gucumber integration tests support.
swf Package swf provides gucumber integration tests support.
waf Package waf provides gucumber integration tests support.
workspaces Package workspaces provides gucumber integration tests support.
mock
performance Package performance provides gucumber integration tests support.
unit Package unit performs initialization and validation for unit tests
example
aws
endpoints
customEndpoint
enumEndpoints
request
handleServiceErrorCodes
withContext
service
cloudfront
signCookies
dynamodb
scanItems
unitTest Package unitTest demonstrates how to unit test, without needing to pass a connector to every function, code that uses DynamoDB.
ec2
filterInstances
rds
rdsutils
authentication
s3
concatObjects
listObjects
listObjectsConcurrently
presignURL
client
server
putObjectAcl
sqs
mockingClientsForTests
models
endpoints Package endpoints contains the models for endpoints that should be used to generate endpoint definition files for the SDK.
protocol_tests
private
model
api Package api represents API abstractions for rendering service generated files.
cli
api-info
gen-api Command aws-gen-gocli parses a JSON description of an AWS API and generates a Go file containing a client for the API.
gen-endpoints Command gen-endpoints parses a JSON description of the AWS endpoint discovery logic and generates a Go file which returns an endpoint.
protocol
ec2query Package ec2query provides serialization of AWS EC2 requests and responses.
json
jsonutil Package jsonutil provides JSON serialization of AWS requests and responses.
jsonrpc Package jsonrpc provides JSON RPC utilities for serialization of AWS requests and responses.
query Package query provides serialization of AWS query requests, and responses.
queryutil
rest Package rest provides RESTful serialization of AWS requests and responses.
restjson Package restjson provides RESTful JSON serialization of AWS requests and responses.
restxml Package restxml provides RESTful XML serialization of AWS requests and responses.
xml
xmlutil Package xmlutil provides XML serialization of AWS requests and responses.
signer
v2
util
service Package service contains automatically generated AWS clients.
acm Package acm provides the client and types for making API requests to AWS Certificate Manager.
acmiface Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
apigateway Package apigateway provides the client and types for making API requests to Amazon API Gateway.
apigatewayiface Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
applicationautoscaling Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
applicationautoscalingiface Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
applicationdiscoveryservice Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
applicationdiscoveryserviceiface Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
appstream Package appstream provides the client and types for making API requests to Amazon AppStream.
appstreamiface Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
athena Package athena provides the client and types for making API requests to Amazon Athena.
athenaiface Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
autoscaling Package autoscaling provides the client and types for making API requests to Auto Scaling.
autoscalingiface Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
batch Package batch provides the client and types for making API requests to AWS Batch.
batchiface Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
budgets Package budgets provides the client and types for making API requests to AWS Budgets.
budgetsiface Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
clouddirectory Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
clouddirectoryiface Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
cloudformation Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
cloudformationiface Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
cloudfront Package cloudfront provides the client and types for making API requests to Amazon CloudFront.
cloudfrontiface Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
sign Package sign provides utilities to generate signed URLs for Amazon CloudFront.
cloudhsm Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM.
cloudhsmiface Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
cloudsearch Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
cloudsearchiface Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
cloudsearchdomain Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
cloudsearchdomainiface Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
cloudtrail Package cloudtrail provides the client and types for making API requests to AWS CloudTrail.
cloudtrailiface Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
cloudwatch Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch.
cloudwatchiface Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
cloudwatchevents Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
cloudwatcheventsiface Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
cloudwatchlogs Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
cloudwatchlogsiface Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
codebuild Package codebuild provides the client and types for making API requests to AWS CodeBuild.
codebuildiface Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
codecommit Package codecommit provides the client and types for making API requests to AWS CodeCommit.
codecommitiface Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
codedeploy Package codedeploy provides the client and types for making API requests to AWS CodeDeploy.
codedeployiface Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
codepipeline Package codepipeline provides the client and types for making API requests to AWS CodePipeline.
codepipelineiface Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
codestar Package codestar provides the client and types for making API requests to AWS CodeStar.
codestariface Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
cognitoidentity Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
cognitoidentityiface Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
cognitoidentityprovider Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
cognitoidentityprovideriface Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
cognitosync Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
cognitosynciface Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
configservice Package configservice provides the client and types for making API requests to AWS Config.
configserviceiface Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
costandusagereportservice Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
costandusagereportserviceiface Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
databasemigrationservice Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
databasemigrationserviceiface Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
datapipeline Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
datapipelineiface Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
devicefarm Package devicefarm provides the client and types for making API requests to AWS Device Farm.
devicefarmiface Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
directconnect Package directconnect provides the client and types for making API requests to AWS Direct Connect.
directconnectiface Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
directoryservice Package directoryservice provides the client and types for making API requests to AWS Directory Service.
directoryserviceiface Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
dynamodb Package dynamodb provides the client and types for making API requests to Amazon DynamoDB.
dynamodbattribute Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
dynamodbiface Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
dynamodbstreams Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
dynamodbstreamsiface Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
ec2 Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.
ec2iface Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
ecr Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry.
ecriface Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
ecs Package ecs provides the client and types for making API requests to Amazon EC2 Container Service.
ecsiface Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
efs Package efs provides the client and types for making API requests to Amazon Elastic File System.
efsiface Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
elasticache Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
elasticacheiface Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
elasticbeanstalk Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.
elasticbeanstalkiface Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
elasticsearchservice Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
elasticsearchserviceiface Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
elastictranscoder Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
elastictranscoderiface Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
elb Package elb provides the client and types for making API requests to Elastic Load Balancing.
elbiface Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
elbv2 Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.
elbv2iface Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
emr Package emr provides the client and types for making API requests to Amazon Elastic MapReduce.
emriface Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
firehose Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose.
firehoseiface Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
gamelift Package gamelift provides the client and types for making API requests to Amazon GameLift.
gameliftiface Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
glacier Package glacier provides the client and types for making API requests to Amazon Glacier.
glacieriface Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
greengrass Package greengrass provides the client and types for making API requests to AWS Greengrass.
greengrassiface Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
health Package health provides the client and types for making API requests to AWS Health APIs and Notifications.
healthiface Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
iam Package iam provides the client and types for making API requests to AWS Identity and Access Management.
iamiface Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
inspector Package inspector provides the client and types for making API requests to Amazon Inspector.
inspectoriface Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
iot Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected things (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud.
iotiface Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
iotdataplane Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
iotdataplaneiface Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
kinesis Package kinesis provides the client and types for making API requests to Amazon Kinesis.
kinesisiface Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
kinesisanalytics Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.
kinesisanalyticsiface Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
kms Package kms provides the client and types for making API requests to AWS Key Management Service.
kmsiface Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
lambda Package lambda provides the client and types for making API requests to AWS Lambda.
lambdaiface Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
lexmodelbuildingservice Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
lexmodelbuildingserviceiface Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
lexruntimeservice Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
lexruntimeserviceiface Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
lightsail Package lightsail provides the client and types for making API requests to Amazon Lightsail.
lightsailiface Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
machinelearning Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
machinelearningiface Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
marketplacecommerceanalytics Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
marketplacecommerceanalyticsiface Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
marketplaceentitlementservice Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
marketplaceentitlementserviceiface Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
marketplacemetering Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
marketplacemeteringiface Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
mobileanalytics Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
mobileanalyticsiface Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
mturk Package mturk provides the client and types for making API requests to Amazon Mechanical Turk.
mturkiface Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
opsworks Package opsworks provides the client and types for making API requests to AWS OpsWorks.
opsworksiface Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
opsworkscm Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate.
opsworkscmiface Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code.
organizations Package organizations provides the client and types for making API requests to AWS Organizations.
organizationsiface Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
pinpoint Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
pinpointiface Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
polly Package polly provides the client and types for making API requests to Amazon Polly.
pollyiface Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
rds Package rds provides the client and types for making API requests to Amazon Relational Database Service.
rdsiface Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
rdsutils
redshift Package redshift provides the client and types for making API requests to Amazon Redshift.
redshiftiface Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
rekognition Package rekognition provides the client and types for making API requests to Amazon Rekognition.
rekognitioniface Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
resourcegroupstaggingapi Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
resourcegroupstaggingapiiface Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
route53 Package route53 provides the client and types for making API requests to Amazon Route 53.
route53iface Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
route53domains Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
route53domainsiface Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
s3 Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.
s3crypto Package s3crypto provides encryption to S3 using KMS and AES GCM.
s3iface Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
s3manager Package s3manager provides utilities to upload and download objects from S3 concurrently.
s3manageriface Package s3manageriface provides an interface for the s3manager package
servicecatalog Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
servicecatalogiface Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
ses Package ses provides the client and types for making API requests to Amazon Simple Email Service.
sesiface Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
sfn Package sfn provides the client and types for making API requests to AWS Step Functions.
sfniface Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
shield Package shield provides the client and types for making API requests to AWS Shield.
shieldiface Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
simpledb Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
simpledbiface Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
sms Package sms provides the client and types for making API requests to AWS Server Migration Service.
smsiface Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
snowball Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball.
snowballiface Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
sns Package sns provides the client and types for making API requests to Amazon Simple Notification Service.
snsiface Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
sqs Package sqs provides the client and types for making API requests to Amazon Simple Queue Service.
sqsiface Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
ssm Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).
ssmiface Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
storagegateway Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
storagegatewayiface Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
sts Package sts provides the client and types for making API requests to AWS Security Token Service.
stsiface Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
support Package support provides the client and types for making API requests to AWS Support.
supportiface Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
swf Package swf provides the client and types for making API requests to Amazon Simple Workflow Service.
swfiface Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
waf Package waf provides the client and types for making API requests to AWS WAF.
wafiface Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
wafregional Package wafregional provides the client and types for making API requests to AWS WAF Regional.
wafregionaliface Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
workdocs Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
workdocsiface Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
workspaces Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
workspacesiface Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
xray Package xray provides the client and types for making API requests to AWS X-Ray.
xrayiface Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.
beorn7
perks
histogram Package histogram provides a Go implementation of BigML's histogram package for Clojure/Java.
quantile Package quantile computes approximate quantiles over an unbounded data stream within low memory and CPU bounds.
topk
bradfitz
gomemcache
memcache Package memcache provides a client for the memcached cache server.
coreos
etcd Package main is a simple wrapper of the real etcd entrypoint package (located at github.com/coreos/etcd/etcdmain) to ensure that etcd is still "go getable"; e.g.
alarm Package alarm manages health status alarms in etcd.
auth Package auth provides client role authentication for accessing keys in etcd.
authpb Package authpb is a generated protocol buffer package.
client Package client provides bindings for the etcd APIs.
integration Package integration implements tests built upon embedded etcd, focusing on the correctness of the etcd v2 client.
clientv3 Package clientv3 implements the official Go etcd client for v3.
clientv3util Package clientv3util contains utility functions derived from clientv3.
concurrency Package concurrency implements concurrency operations on top of etcd such as distributed locks, barriers, and elections.
integration Package integration implements tests built upon embedded etcd, and focuses on correctness of etcd client.
mirror Package mirror implements etcd mirroring operations.
namespace Package namespace is a clientv3 wrapper that translates all keys to begin with a given prefix.
naming Package naming provides an etcd-backed gRPC resolver for discovering gRPC services.
yaml Package yaml handles yaml-formatted clientv3 configuration data.
cmd
compactor Package compactor implements automated policies for compacting etcd's mvcc storage.
contrib
raftexample raftexample is a simple KV store using the raft and rafthttp libraries.
recipes Package recipe contains experimental client-side distributed synchronization primitives.
systemd
etcd2-backup-coreos
discovery Package discovery provides an implementation of the cluster discovery that is used by etcd.
e2e Package e2e implements tests built upon etcd binaries, and focus on end-to-end testing.
embed Package embed provides bindings for embedding an etcd server in a program.
error Package error describes errors in etcd project.
etcdctl etcdctl is a command line application that controls etcd.
ctlv2 Package ctlv2 contains the main entry point for the etcdctl for v2 API.
command Package command is a set of libraries for etcdctl commands.
ctlv3 Package ctlv3 contains the main entry point for the etcdctl for v3 API.
command Package command is a set of libraries for etcd v3 commands.
etcdmain Package etcdmain contains the main entry point for the etcd binary.
etcdserver Package etcdserver defines how etcd servers interact and store their states.
api Package api manages the capabilities and features that are exposed to clients by the etcd cluster.
v2http Package v2http provides etcd client and server implementations.
httptypes Package httptypes defines how etcd's HTTP API entities are serialized to and deserialized from JSON.
v3client Package v3client provides clientv3 interfaces from an etcdserver.
v3election Package v3election provides a v3 election service from an etcdserver.
v3electionpb Package v3electionpb is a generated protocol buffer package.
gw Package v3electionpb is a reverse proxy.
v3lock Package v3lock provides a v3 locking service from an etcdserver.
v3lockpb Package v3lockpb is a generated protocol buffer package.
gw Package v3lockpb is a reverse proxy.
v3rpc Package v3rpc implements etcd v3 RPC system based on gRPC.
rpctypes Package rpctypes has types and values shared by the etcd server and client for v3 RPC interaction.
auth Package auth implements etcd authentication.
etcdserverpb Package etcdserverpb is a generated protocol buffer package.
gw Package etcdserverpb is a reverse proxy.
membership Package membership describes individual etcd members and clusters of members.
stats Package stats defines a standard interface for etcd cluster statistics.
integration Package integration implements tests built upon embedded etcd, and focus on etcd correctness.
lease Package lease provides an interface and implemetation for time-limited leases over arbitrary resources.
leasehttp Package leasehttp serves lease renewals made through HTTP requests.
leasepb Package leasepb is a generated protocol buffer package.
mvcc Package mvcc defines etcd's stable MVCC storage.
backend Package backend defines a standard interface for etcd's backend MVCC storage.
mvccpb Package mvccpb is a generated protocol buffer package.
pkg
adt Package adt implements useful abstract data types.
contention Package contention provides facilities for detecting system contention.
cors Package cors handles cross-origin HTTP requests (CORS).
cpuutil Package cpuutil provides facilities for detecting cpu-specific features.
crc Package crc provides utility function for cyclic redundancy check algorithms.
debugutil Package debugutil includes utility functions for debugging.
expect Package expect implements a small expect-style interface
fileutil Package fileutil implements utility functions related to files and paths.
flags Package flags implements command-line flag parsing.
httputil Package httputil provides HTTP utility functions.
idutil Package idutil implements utility functions for generating unique, randomized ids.
ioutil Package ioutil implements I/O utility functions.
logutil Package logutil includes utilities to facilitate logging.
mock
mockstorage Package mockstorage provides mock implementations for etcdserver's storage interface.
mockstore Package mockstore provides mock structures for the etcd store package.
mockwait Package mockwait provides mock implementations for pkg/wait.
monotime Package monotime provides a fast monotonic clock source.
netutil Package netutil implements network-related utility functions.
osutil Package osutil implements operating system-related utility functions.
pathutil Package pathutil implements utility functions for handling slash-separated paths.
pbutil Package pbutil defines interfaces for handling Protocol Buffer objects.
report Package report generates human-readable benchmark reports.
runtime Package runtime implements utility functions for runtime systems.
schedule Package schedule provides mechanisms and policies for scheduling units of work.
srv Package srv looks up DNS SRV records.
stringutil Package stringutil exports string utility functions.
testutil Package testutil provides test utility functions.
tlsutil Package tlsutil provides utility functions for handling TLS.
transport Package transport implements various HTTP transport utilities based on Go net package.
types Package types declares various data types and implements type-checking functions.
wait Package wait provides utility functions for polling, listening using Go channel.
proxy
grpcproxy Package grpcproxy is an OSI level 7 proxy for etcd v3 API requests.
adapter Package adapter provides gRPC adapters between client and server gRPC interfaces without needing to go through a gRPC connection.
cache Package cache exports functionality for efficiently caching and mapping `RangeRequest`s to corresponding `RangeResponse`s.
httpproxy Package httpproxy implements etcd httpproxy.
tcpproxy Package tcpproxy is an OSI level 4 proxy for routing etcd clients to etcd servers.
raft Package raft sends and receives messages in the Protocol Buffer format defined in the raftpb package.
raftpb Package raftpb is a generated protocol buffer package.
rafttest Package rafttest provides functional tests for etcd's raft implementation.
rafthttp Package rafthttp implements HTTP transportation layer for etcd/raft pkg.
snap Package snap stores raft nodes' states with snapshots.
snappb Package snappb is a generated protocol buffer package.
store Package store defines etcd's in-memory key/value store.
tools
benchmark benchmark is a program for benchmarking etcd v3 API performance.
cmd Package cmd implements individual benchmark commands for the benchmark utility.
etcd-dump-db etcd-dump-db inspects etcd db files.
etcd-dump-logs etcd-dump-logs is a program for analyzing etcd server write ahead logs.
functional-tester
etcd-agent etcd-agent is a daemon for controlling an etcd process via HTTP RPC.
client Package client provides a client implementation to control an etcd-agent.
etcd-runner etcd-runner is a program for testing etcd clientv3 features against a fault injected cluster.
command Package command implements individual etcd-runner commands for the etcd-runner utility.
etcd-tester etcd-tester is a single controller for all etcd-agents to manage an etcd cluster and simulate failures.
local-tester
bridge Package main is the entry point for the local tester network bridge.
version Package version implements etcd version parsing and contains latest version information.
wal Package wal provides an implementation of a write ahead log that is used by etcd.
walpb Package walpb is a generated protocol buffer package.
go-semver
semver Semantic Versions http://semver.org
davecgh
go-spew
spew Package spew implements a deep pretty printer for Go data structures to aid in debugging.
denisenkom
go-mssqldb package mssql implements the TDS protocol used to connect to MS SQL Server (sqlserver) database servers.
batch bach splits a single script containing multiple batches separated by a keyword into multiple scripts.
examples
bulk
simple
tsql
dgrijalva
jwt-go Package jwt is a Go implementation of JSON Web Tokens: http://self-issued.info/docs/draft-jones-json-web-token.html See README.md for more info.
cmd
jwt A useful example app.
request Utility package for extracting JWT tokens from HTTP requests.
test
eapache
go-resiliency
batcher Package batcher implements the batching resiliency pattern for Go.
breaker Package breaker implements the circuit-breaker resiliency pattern for Go.
deadline Package deadline implements the deadline (also known as "timeout") resiliency pattern for Go.
retrier Package retrier implements the "retriable" resiliency pattern for Go.
semaphore Package semaphore implements the semaphore resiliency pattern for Go.
go-xerial-snappy
queue Package queue provides a fast, ring-buffer queue based on the version suggested by Dariusz GΓ³recki.
go-kit
kit
auth
jwt
circuitbreaker Package circuitbreaker implements the circuit breaker pattern.
endpoint Package endpoint defines an abstraction for RPCs.
log Package log provides a structured logger.
deprecated_levels
level Package level implements leveled logging on top of package log.
term Package term provides tools for logging to a terminal.
metrics Package metrics provides a framework for application instrumentation.
discard Package discard provides a no-op metrics backend.
dogstatsd Package dogstatsd provides a DogStatsD backend for package metrics.
expvar Package expvar provides expvar backends for metrics.
generic Package generic implements generic versions of each of the metric types.
graphite Package graphite provides a Graphite backend for metrics.
influx Package influx provides an InfluxDB implementation for metrics.
multi Package multi provides adapters that send observations to multiple metrics simultaneously.
pcp
prometheus Package prometheus provides Prometheus implementations for metrics.
provider Package provider provides a factory-like abstraction for metrics backends.
statsd Package statsd provides a StatsD backend for package metrics.
teststat Package teststat provides helpers for testing metrics backends.
ratelimit
sd Package sd provides utilities related to service discovery.
cache
consul Package consul provides subscriber and registrar implementations for Consul.
dnssrv Package dnssrv provides a subscriber implementation for DNS SRV records.
etcd Package etcd provides a Subscriber and Registrar implementation for etcd.
lb Package lb implements the client-side load balancer pattern.
zk Package zk provides subscriber and registrar implementations for ZooKeeper.
tracing Package tracing provides helpers and bindings for distributed tracing.
opentracing Package opentracing provides Go kit integration to the OpenTracing project.
transport Package transport contains bindings to concrete transports.
grpc Package grpc provides a gRPC binding for endpoints.
http Package http provides a general purpose HTTP binding for endpoints.
httprp Package httprp provides an HTTP reverse-proxy transport.
util
conn Package conn provides utilities related to connections.
go-log
log Package log provides a log interface
appengine
fmt
log
logrus
go-logfmt
logfmt Package logfmt implements utilities to marshal and unmarshal data in the logfmt format.
go-redis
redis Package redis implements a Redis client.
go-sql-driver
mysql Package mysql provides a MySQL driver for Go's database/sql package The driver should be used via the database/sql package: import "database/sql" import _ "github.com/go-sql-driver/mysql" db, err := sql.Open("mysql", "user:password@/dbname") See https://github.com/go-sql-driver/mysql#usage for details
go-stack
stack Package stack implements utilities to capture, manipulate, and format call stacks.
gocql
gocql Package gocql implements a fast and robust Cassandra driver for the Go programming language.
gogo
protobuf
codec
gogoproto Package gogoproto provides extensions for protocol buffers to achieve: - fast marshalling and unmarshalling.
gogoreplace
io
jsonpb Package jsonpb provides marshaling and unmarshaling between protocol buffers and JSON.
jsonpb_test_proto Package jsonpb is a generated protocol buffer package.
plugin
compare
defaultcheck The defaultcheck plugin is used to check whether nullable is not used incorrectly.
description The description (experimental) plugin generates a Description method for each message.
embedcheck The embedcheck plugin is used to check whether embed is not used incorrectly.
enumstringer The enumstringer (experimental) plugin generates a String method for each enum.
equal The equal plugin generates an Equal and a VerboseEqual method for each message.
face The face plugin generates a function will be generated which can convert a structure which satisfies an interface (face) to the specified structure.
gostring The gostring plugin generates a GoString method for each message.
marshalto The marshalto plugin generates a Marshal and MarshalTo method for each message.
oneofcheck The oneofcheck plugin is used to check whether oneof is not used incorrectly.
populate The populate plugin generates a NewPopulated function.
size The size plugin generates a Size or ProtoSize method for each message.
stringer The stringer plugin generates a String method for each message.
testgen The testgen plugin generates Test and Benchmark functions for each message.
union The onlyone plugin generates code for the onlyone extension.
unmarshal The unmarshal plugin generates a Unmarshal method for each message.
proto Package proto converts data structures to and from the wire format of protocol buffers.
proto3_proto Package proto3_proto is a generated protocol buffer package.
protoc-gen-combo
protoc-gen-gofast
protoc-gen-gogo protoc-gen-go is a plugin for the Google protocol buffer compiler to generate Go code.
descriptor Package descriptor provides functions for obtaining protocol buffer descriptors for generated Go types.
generator The code generator for the plugin for the Google protocol buffer compiler.
grpc Package grpc outputs gRPC service descriptions in Go code.
plugin Package plugin_go is a generated protocol buffer package.
protoc-gen-gogofast
protoc-gen-gogofaster
protoc-gen-gogoslick
protoc-gen-gogotypes
protoc-gen-gostring
protoc-min-version
sortkeys
test Package test is a generated protocol buffer package.
asymetric-issue125 Package asym is a generated protocol buffer package.
casttype
combos
both Package casttype is a generated protocol buffer package.
marshaler Package casttype is a generated protocol buffer package.
neither Package casttype is a generated protocol buffer package.
unmarshaler Package casttype is a generated protocol buffer package.
unsafeboth Package casttype is a generated protocol buffer package.
unsafemarshaler Package casttype is a generated protocol buffer package.
unsafeunmarshaler Package casttype is a generated protocol buffer package.
castvalue Package castvalue is a generated protocol buffer package.
combos
both Package castvalue is a generated protocol buffer package.
marshaler Package castvalue is a generated protocol buffer package.
unmarshaler Package castvalue is a generated protocol buffer package.
unsafeboth Package castvalue is a generated protocol buffer package.
unsafemarshaler Package castvalue is a generated protocol buffer package.
unsafeunmarshaler Package castvalue is a generated protocol buffer package.
combos
both Package test is a generated protocol buffer package.
marshaler Package test is a generated protocol buffer package.
unmarshaler Package test is a generated protocol buffer package.
unsafeboth Package test is a generated protocol buffer package.
unsafemarshaler Package test is a generated protocol buffer package.
unsafeunmarshaler Package test is a generated protocol buffer package.
custom Package custom contains custom types for test and example purposes.
custom-dash-type Package custom contains custom types for test and example purposes.
custombytesnonstruct Package custombytesnonstruct is a generated protocol buffer package.
dashfilename
data Package data is a generated protocol buffer package.
defaultconflict
embedconflict
empty-issue70 Package empty is a generated protocol buffer package.
enumcustomname Package enumcustomname is a generated protocol buffer package.
enumdecl Package enumdecl is a generated protocol buffer package.
enumdecl_all Package enumdeclall is a generated protocol buffer package.
enumprefix Package enumprefix is a generated protocol buffer package.
enumstringer Package enumstringer is a generated protocol buffer package.
example Package test is a generated protocol buffer package.
filedotname Package filedotname is a generated protocol buffer package.
fuzztests Package fuzztests is a generated protocol buffer package.
group Package group is a generated protocol buffer package.
importdedup Package importdedup is a generated protocol buffer package.
subpkg Package subpkg is a generated protocol buffer package.
indeximport-issue72 Package indeximport is a generated protocol buffer package.
index Package index is a generated protocol buffer package.
issue260 Package issue260 is a generated protocol buffer package.
issue261 Package issue261 is a generated protocol buffer package.
issue262 Package timefail is a generated protocol buffer package.
issue34 Package issue34 is a generated protocol buffer package.
issue42order Package issue42 is a generated protocol buffer package.
issue8 Package proto is a generated protocol buffer package.
mapsproto2
combos
both Package proto2_maps is a generated protocol buffer package.
marshaler Package proto2_maps is a generated protocol buffer package.
neither Package proto2_maps is a generated protocol buffer package.
unmarshaler Package proto2_maps is a generated protocol buffer package.
unsafeboth Package proto2_maps is a generated protocol buffer package.
unsafemarshaler Package proto2_maps is a generated protocol buffer package.
unsafeunmarshaler Package proto2_maps is a generated protocol buffer package.
mixbench
moredefaults Package moredefaults is a generated protocol buffer package.
nopackage Package nopackage is a generated protocol buffer package.
oneof
combos
both Package one is a generated protocol buffer package.
marshaler Package one is a generated protocol buffer package.
neither Package one is a generated protocol buffer package.
unmarshaler Package one is a generated protocol buffer package.
unsafeboth Package one is a generated protocol buffer package.
unsafemarshaler Package one is a generated protocol buffer package.
unsafeunmarshaler Package one is a generated protocol buffer package.
oneof3
combos
both Package one is a generated protocol buffer package.
marshaler Package one is a generated protocol buffer package.
neither Package one is a generated protocol buffer package.
unmarshaler Package one is a generated protocol buffer package.
unsafeboth Package one is a generated protocol buffer package.
unsafemarshaler Package one is a generated protocol buffer package.
unsafeunmarshaler Package one is a generated protocol buffer package.
oneofembed Package proto is a generated protocol buffer package.
packed Package packed is a generated protocol buffer package.
proto3extension Package proto3extension is a generated protocol buffer package.
protosize Package protosize is a generated protocol buffer package.
required Package required is a generated protocol buffer package.
sizeunderscore Package sizeunderscore is a generated protocol buffer package.
stdtypes Package stdtypes is a generated protocol buffer package.
tags Package tags is a generated protocol buffer package.
theproto3
combos
both Package theproto3 is a generated protocol buffer package.
marshaler Package theproto3 is a generated protocol buffer package.
neither Package theproto3 is a generated protocol buffer package.
unmarshaler Package theproto3 is a generated protocol buffer package.
unsafeboth Package theproto3 is a generated protocol buffer package.
unsafemarshaler Package theproto3 is a generated protocol buffer package.
unsafeunmarshaler Package theproto3 is a generated protocol buffer package.
typedecl Package typedecl is a generated protocol buffer package.
typedecl_all Package typedeclall is a generated protocol buffer package.
types
combos
both Package types is a generated protocol buffer package.
marshaler Package types is a generated protocol buffer package.
neither Package types is a generated protocol buffer package.
unmarshaler Package types is a generated protocol buffer package.
unsafeboth Package types is a generated protocol buffer package.
unsafemarshaler Package types is a generated protocol buffer package.
unsafeunmarshaler Package types is a generated protocol buffer package.
unmarshalmerge Package unmarshalmerge is a generated protocol buffer package.
unrecognized Package unrecognized is a generated protocol buffer package.
unrecognizedgroup Package unrecognizedgroup is a generated protocol buffer package.
types Package types is a generated protocol buffer package.
vanity
command
test
fast Package vanity is a generated protocol buffer package.
faster Package vanity is a generated protocol buffer package.
slick Package vanity is a generated protocol buffer package.
version
golang
glog Package glog implements logging analogous to the Google-internal C++ INFO/ERROR/V setup.
lint Package lint contains a linter for Go source code.
golint golint lints the Go source files named on its command line.
mock
gomock GoMock - a mock framework for Go.
mock_matcher
mockgen MockGen generates mock implementations of Go interfaces.
model Package model contains the data model necessary for generating mock implementations.
sample An example package with an interface.
imp1
imp2
imp3
imp4
mock_user
protobuf
descriptor Package descriptor provides functions for obtaining protocol buffer descriptors for generated Go types.
jsonpb Package jsonpb provides marshaling and unmarshaling between protocol buffers and JSON.
jsonpb_test_proto Package jsonpb is a generated protocol buffer package.
proto Package proto converts data structures to and from the wire format of protocol buffers.
proto3_proto Package proto3_proto is a generated protocol buffer package.
protoc-gen-go protoc-gen-go is a plugin for the Google protocol buffer compiler to generate Go code.
descriptor Package descriptor is a generated protocol buffer package.
generator The code generator for the plugin for the Google protocol buffer compiler.
grpc Package grpc outputs gRPC service descriptions in Go code.
plugin Package plugin_go is a generated protocol buffer package.
ptypes Package ptypes contains code for interacting with well-known types.
any Package any is a generated protocol buffer package.
duration Package duration is a generated protocol buffer package.
empty Package empty is a generated protocol buffer package.
struct Package structpb is a generated protocol buffer package.
timestamp Package timestamp is a generated protocol buffer package.
wrappers Package wrappers is a generated protocol buffer package.
snappy Package snappy implements the snappy block-based compression format.
google
uuid Package uuid generates and inspects UUIDs.
googleapis
gax-go Package gax contains a set of modules which aid the development of APIs for clients and servers based on gRPC and Google API conventions.
gorilla
mux Package mux implements a request router and dispatcher.
websocket Package websocket implements the WebSocket protocol defined in RFC 6455.
examples
autobahn Command server is a test server for the Autobahn WebSockets Test Suite.
chat
command
echo
filewatch
hailocab
go-hostpool A Go package to intelligently and flexibly pool among multiple hosts from your Go application.
hashicorp
consul
acl
api The /v1/operator/area endpoints are available only in Consul Enterprise and interact with its network area subsystem.
command
agent
mock
base
consul The snapshot endpoint is a special non-RPC endpoint that supports streaming for taking and restoring snapshots for disaster recovery.
agent Package agent provides a logical endpoint for Consul agents in the network.
prepared_query
servers Package servers provides a Manager interface for Manager managed agent.Server objects.
state
structs
ipaddr
lib
logger
snapshot The archive utilities manage the internal format of a snapshot, which is a tar file with the following contents: meta.json - JSON-encoded snapshot metadata from Raft state.bin - Encoded snapshot data from Raft SHA256SUMS - SHA-256 sums of the above two files The integrity information is automatically created and checked, and a failure there just looks like an error to the caller.
testrpc
testutil
retry Package retry provides support for repeating operations in tests.
tlsutil
types
version
watch
influxdata
influxdb Package influxdb is the root package of InfluxDB, the scalable datastore for metrics, events, and real-time analytics.
client Package client implements a now-deprecated client for InfluxDB; use github.com/influxdata/influxdb/client/v2 instead.
v2 Package client (v2) is the current official Go client for InfluxDB.
cmd Package cmd is the root package of the various command-line utilities for InfluxDB.
influx The influx command is a CLI client to InfluxDB.
cli Package cli contains the logic of the influx command line client.
influx_inspect The influx_inspect command displays detailed information about InfluxDB data files.
dumptsm Package dumptsm inspects low-level details about tsm1 files.
export Package export exports TSM files into InfluxDB line protocol format.
help Package help contains the help for the influx_inspect command.
report Package report reports statistics about TSM files.
verify Package verify verifies integrity of TSM files.
influx_stress Command influx_stress is deprecated; use github.com/influxdata/influx-stress instead.
influx_tsm Command influx_tsm converts b1 or bz1 shards (from InfluxDB releases earlier than v0.11) to the current tsm1 format.
b1 Package b1 reads data from b1 shards.
bz1 Package bz1 reads data from bz1 shards.
stats Package stats contains statistics for converting non-TSM shards to TSM.
tsdb Pacage tsdb abstracts the various shard types supported by the influx_tsm command.
influxd Command influxd is the InfluxDB server.
backup Package backup is the backup subcommand for the influxd command.
help Package help is the help subcommand of the influxd command.
restore Package restore is the restore subcommand for the influxd command, for restoring from a backup.
run Package run is the run (default) subcommand for the influxd command.
coordinator Package coordinator contains abstractions for writing points, executing statements, and accessing meta data.
importer
v8 Package v8 contains code for importing data from 0.8 instances of InfluxDB.
influxql Package influxql implements a parser for the InfluxDB query language.
neldermead Package neldermead is an implementation of the Nelder-Mead optimization method.
models Package models implements basic objects used throughout the TICK stack.
monitor Package monitor provides a service and associated functionality for InfluxDB to self-monitor internal statistics and diagnostics.
diagnostics Package diagnostics provides the diagnostics type so that other packages can provide diagnostics without depending on the monitor package.
pkg
deep Package deep provides a deep equality check for use in tests.
escape Package escape contains utilities for escaping parts of InfluxQL and InfluxDB line protocol.
limiter Package limiter provides concurrency limiters.
pool Package pool provides pool structures to help reduce garbage collector pressure.
slices Package slices contains functions to operate on slices treated as sets.
services
admin
statik
collectd Package collectd provides a service for InfluxDB to ingest data via the collectd protocol.
test_client
continuous_querier Package continuous_querier provides the continuous query service.
graphite Package graphite provides a service for InfluxDB to ingest data via the graphite protocol.
httpd Package httpd implements the HTTP service and REST API for InfluxDB.
meta Package meta provides control over meta data for InfluxDB, such as controlling databases, retention policies, users, etc.
opentsdb Package opentsdb provides a service for InfluxDB to ingest data via the opentsdb protocol.
precreator Package precreator provides the shard precreation service.
retention Package retention provides the retention policy enforcement service.
snapshotter Package snapshotter provides the meta snapshot service.
subscriber Package subscriber implements the subscriber service to forward incoming data to remote services.
udp Package udp provides the UDP input service for InfluxDB.
stress
stress_test_server
v2
statement
stress_client
stressql
statement
tcp Package tcp provides a simple multiplexer over TCP.
tests
urlgen
toml Package toml adds support to marshal and unmarshal types not in the official TOML spec.
tsdb Package tsdb implements a durable time series database.
engine Package engine can be imported to initialize and register all available TSDB engines.
tsm1 Package tsm1 provides a TSDB in the Time Structured Merge tree format.
uuid Package uuid provides functions to create time-based UUIDs.
jackc
pgx Package pgx is a PostgreSQL database driver.
examples
chat
todo
url_shortener
stdlib Package stdlib is the compatibility layer from pgx to database/sql.
jmoiron
sqlx Package sqlx provides general purpose extensions to database/sql.
reflectx Package reflectx implements extensions to the standard reflect lib suitable for implementing marshalling and unmarshalling packages.
types
juju
ratelimit Package ratelimit provides an efficient token bucket implementation that can be used to limit the rate of arbitrary things.
klauspost
compress
flate Package flate implements the DEFLATE compressed data format, described in RFC 1951.
gzip Package gzip implements reading and writing of gzip format compressed files, as specified in RFC 1952.
snappy Package snappy implements the snappy block-based compression format.
zip Package zip provides support for reading and writing ZIP archives.
zlib Package zlib implements reading and writing of zlib format compressed data, as specified in RFC 1950.
cpuid Package cpuid provides information about the CPU running the current program.
private
crc32 Package crc32 implements the 32-bit cyclic redundancy check, or CRC-32, checksum.
lib
pq Package pq is a pure Go Postgres driver for the database/sql package.
hstore
listen_example Below you will find a self-contained Go program which uses the LISTEN / NOTIFY mechanism to avoid polling the database while waiting for more work to arrive.
oid Package oid contains OID constants as defined by the Postgres server.
lightstep
lightstep-tracer-go
basictracer
cmd
benchmark
sendspan
collectorpb Package collectorpb is a generated protocol buffer package.
examples
lightstep_thrift
lightsteppb Package lightstep is a generated protocol buffer package.
thrift_0_9_2
lib
go
thrift
thrift_rpc
mattn
go-oci8
matttproud
golang_protobuf_extensions
ext Package ext moved to a new location: github.com/matttproud/golang_protobuf_extensions/pbutil.
pbtest Package pbtest is deleted for the time being, because upstream Protocol Buffer 3 may have rendered quick.Value-based blackbox generation impossible.
pbutil Package pbutil provides record length-delimited Protocol Buffer streaming.
micro
cli Package cli provides a minimal framework for creating and organizing command line Go applications.
altsrc
go-log
go-micro Package micro is a pluggable RPC framework for microservices
broker Package broker is an interface used for asynchronous messaging
codec
json
noop
http
mock
client Package client is an interface for an RPC client
mock
rpc
cmd Package cmd is an interface for parsing the command line
codec Package codec is an interface for encoding messages
jsonrpc
protorpc Package proto is a generated protocol buffer package.
errors Package errors provides a way to return detailed information for an RPC request error.
metadata Package metadata is a way of defining message headers
registry Package registry is an interface for service discovery
consul
mdns
mock
selector Package selector is a way to load balance service nodes
cache
server Package server is an interface for a micro server
debug
proto Package debug is a generated protocol buffer package.
mock
rpc
transport Package is an interface for synchronous communication
codec
json
noop
http
mock
mdns
examples
client
service
misc
lib
addr
net
tls
miekg
dns Package dns implements a full featured interface to the Domain Name System.
dnsutil Package dnsutil contains higher-level methods useful with the dns package.
idn Package idn implements encoding from and to punycode as speficied by RFC 3492.
mitchellh
hashstructure
onsi
ginkgo Ginkgo is a BDD-style testing framework for Golang The godoc documentation describes Ginkgo's API.
config Ginkgo accepts a number of configuration options.
extensions
table
ginkgo The Ginkgo CLI The Ginkgo CLI is fully documented [here](http://onsi.github.io/ginkgo/#the_ginkgo_cli) You can also learn more by running: ginkgo help Here are some of the more commonly used commands: To install: go install github.com/onsi/ginkgo/ginkgo To run tests: ginkgo To run tests in all subdirectories: ginkgo -r To run tests in particular packages: ginkgo <flags> /path/to/package /path/to/another/package To pass arguments/flags to your tests: ginkgo <flags> <packages> -- <pass-throughs> To run tests in parallel ginkgo -p this will automatically detect the optimal number of nodes to use.
convert
interrupthandler
nodot
testrunner
testsuite
watch
integration
reporters Ginkgo's Default Reporter A number of command line flags are available to tweak Ginkgo's default output.
stenographer
support
go-colorable
go-isatty Package isatty implements interface to isatty
types
gomega Gomega is the Ginkgo BDD-style testing framework's preferred matcher library.
format Gomega's format package pretty-prints objects.
gbytes Package gbytes provides a buffer that supports incrementally detecting input.
gexec Package gexec provides support for testing external processes.
ghttp Package ghttp supports testing HTTP clients by providing a test server (simply a thin wrapper around httptest's server) that supports registering multiple handlers.
protobuf Package protobuf is a generated protocol buffer package.
gstruct
errors
matchers Gomega matchers This package implements the Gomega matchers and does not typically need to be imported.
support
goraph
bipartitegraph
edge
node
util
types
opentracing
basictracer-go
events
examples
dapperish
wire Package wire is a generated protocol buffer package.
opentracing-go
ext
log
mocktracer
openzipkin
zipkin-go-opentracing
events
flag
types
wire Package wire is a generated protocol buffer package.
pborman
uuid The uuid package generates and inspects UUIDs.
performancecopilot
speed Package speed implements a golang client for the Performance Co-Pilot instrumentation API.
bytewriter Package bytewriter implements writers that support concurrent writing within a fixed length block initially tried to use bytes.Buffer but the main restriction with that is that it does not allow the freedom to move around in the buffer.
examples
acme A golang implementation of the acme factory examples from python and Java APIs The python implementation is in mmv.py in PCP core (https://github.com/performancecopilot/pcp/blob/master/src/python/pcp/mmv.py#L21-L70) The Java implementation is in examples in parfait core (https://github.com/performancecopilot/parfait/tree/master/examples/acme) To run the python version of the example that exits do go run examples/acme/main.go To run the java version of the example that runs forever, simply add a --forever flag go run examples/acme/main.go --forever
basic_histogram
http_counter
instance_string
runtime
simple
simple_string_metric
singleton_counter
singleton_string this example showcases speeds metric inference from strings property
mmvdump Package mmvdump implements a go port of the C mmvdump utility included in PCP Core https://github.com/performancecopilot/pcp/blob/master/src/pmdas/mmv/mmvdump.c It has been written for maximum portability with the C equivalent, without having to use cgo or any other ninja stuff the main difference is that the reader is separate from the cli with the reading primarily implemented in mmvdump.go while the cli is implemented in cmd/mmvdump the cli application is completely go gettable and outputs the same things, in mostly the same way as the C cli app, to try it out, ``` go get github.com/performancecopilot/speed/mmvdump/cmd/mmvdump ```
cmd
mmvdump
pierrec
lz4 Package lz4 implements reading and writing lz4 compressed data (a frame), as specified in http://fastcompression.blogspot.fr/2013/04/lz4-streaming-format-final.html, using an io.Reader (decompression) and io.Writer (compression).
fuzz
lz4c Command line utility for the lz4 package.
xxHash
xxHash32 Package xxHash32 implements the very fast xxHash hashing algorithm (32 bits version).
xxHash64 Package xxHash64 implements the very fast xxHash hashing algorithm (64 bits version).
pkg
errors Package errors provides simple error handling primitives.
prometheus
client_golang
api Package api provides clients for the HTTP APIs.
prometheus
v1 Package v1 provides bindings to the Prometheus HTTP API v1: http://prometheus.io/docs/querying/api/
examples
random A simple example exposing fictional RPC latencies with different types of random distributions (uniform, normal, and exponential) as Prometheus metrics.
simple A minimal example of how to include Prometheus instrumentation.
prometheus Package prometheus provides metrics primitives to instrument code for monitoring.
graphite Package graphite provides a bridge to push Prometheus metrics to a Graphite server.
promhttp Package promhttp provides tooling around HTTP servers and clients.
push Package push provides functions to push metrics to a Pushgateway.
client_model
go Package io_prometheus_client is a generated protocol buffer package.
common
config
expfmt Package expfmt contains tools for reading and writing Prometheus metrics.
log
model Package model contains common data structures that are shared across Prometheus components and libraries.
route
version
procfs Package procfs provides functions to retrieve system, kernel and process metrics from the pseudo-filesystem proc.
bcache Package bcache provides access to statistics exposed by the bcache (Linux block cache).
sysfs Package sysfs provides functions to retrieve system and kernel metrics from the pseudo-filesystem sys.
xfs Package xfs provides access to statistics exposed by the XFS filesystem.
rcrowley
go-metrics Go port of Coda Hale's Metrics library <https://github.com/rcrowley/go-metrics> Coda Hale's original work: <https://github.com/codahale/metrics>
cmd
metrics-bench
metrics-example
never-read
exp Hook go-metrics into expvar on any /debug/metrics request, load all vars from the registry into expvar, and execute regular expvar handler
librato
stathat Metrics output to StatHat.
samuel
go-zookeeper
examples
zk Package zk is a native Go client library for the ZooKeeper orchestration service.
shopspring
decimal Package decimal implements an arbitrary precision fixed-point decimal.
sirupsen
logrus Package logrus is a structured logger for Go, completely API compatible with the standard library logger.
examples
basic
hook
hooks
syslog
test The Test package is used for testing logrus.
sony
gobreaker Package gobreaker implements the Circuit Breaker pattern.
example
streadway
handy Package handy organizes some useful http server handler filters or handlers for reuse.
accept Package accept contains filters to reject requests without a specified Accept header with "406 Not Acceptable".
atomic Package atomic implements atomic accessors for primitives
breaker Package breaker implements a circuit breaker with configurable failure thresholds.
cors Package cors contains filters to handle CORS related requests defined from http://www.w3.org/TR/cors/
encoding Package encoding contains Content-Encoding related filters.
proxy Package proxy contains a proxying HTTP transport.
redirect Package redirect contains filters to handle HTTP and HTTPS redirects
report Package report organizes textual reporting from the HTTP context.
retry Package retry implements a retrying transport based on a combination of strategies.
rewrite Package rewrite contains filters to handle HTTP rewrites
statsd Package statsd collects and reports telemetry from http handlers.
stretchr
testify Package testify is a set of packages that provide many tools for testifying that your code will behave as you intend.
assert Package assert provides a set of comprehensive testing tools for use with the normal Go testing system.
http Package http DEPRECATED USE net/http/httptest
mock Package mock provides a system by which it is possible to mock your objects and verify calls are happening as expected.
require Package require implements the same assertions as the `assert` package but stops test execution when a test fails.
suite Package suite contains logic for creating testing suite structs and running the methods on those structs as tests.
tensorflow
tensorflow
tensorflow
go Package tensorflow is a Go binding to TensorFlow.
genop Command genop generates a Go source file with functions for TensorFlow ops.
op Package op defines functions for adding TensorFlow operations to a Graph.
ugorji
go
codec High Performance, Feature-Rich Idiomatic Go codec/encoding library for binc, msgpack, cbor, json.
codecgen codecgen generates codec.Selfer implementations for a set of types.
valyala
bytebufferpool Package bytebufferpool implements a pool of byte buffers with anti-fragmentation protection.
fasthttp Package fasthttp provides fast HTTP server and client API.
examples
fileserver Example static file server.
helloworldserver
expvarhandler Package expvarhandler provides fasthttp-compatible request handler serving expvars.
fasthttpadaptor Package fasthttpadaptor provides helper functions for converting net/http request handlers to fasthttp request handlers.
fasthttputil Package fasthttputil provides utility functions for fasthttp.
reuseport Package reuseport provides TCP net.Listener with SO_REUSEPORT support.
stackless Package stackless provides functionality that may save stack space for high number of concurrently running goroutines.