...
Directory /src/github.com
Name | Synopsis |
---|---|
.. | |
Shopify | |
sarama | Package sarama is a pure Go client library for dealing with Apache Kafka (versions 0.8 and later). |
examples | |
http_server | |
mocks | Package mocks provides mocks that can be used for testing applications that use Sarama. |
tools | |
kafka-console-consumer | |
kafka-console-partitionconsumer | |
kafka-console-producer | |
toxiproxy | |
cli | |
client | Package Toxiproxy provides a client wrapper around the Toxiproxy HTTP API for testing the resiliency of Go applications. |
cmd | |
stream | |
testhelper | |
testing | |
toxics | |
VividCortex | |
gohistogram | Package gohistogram contains implementations of weighted and exponential histograms. |
afex | |
hystrix-go | |
hystrix | Package hystrix is a latency and fault tolerance library designed to isolate points of access to remote systems, services and 3rd party libraries, stop cascading failure and enable resilience in complex distributed systems where failure is inevitable. |
metric_collector | |
rolling | |
loadtest | |
service | Package main implements an http server which executes a hystrix command each request and sends metrics to a statsd instance to aid performance testing. |
plugins | Plugins allows users to operate on statistics recorded for each circuit operation. |
apache | |
thrift | |
lib | |
go | |
test | |
tests | |
thrift | |
test | |
go | |
src | |
bin | |
stress | |
testclient | |
testserver | |
common | |
tutorial | |
go | |
src | |
aws | |
aws-sdk-go | Package sdk is the official AWS SDK for the Go programming language. |
aws | Package aws provides the core SDK's utilities and shared types. |
awserr | Package awserr represents API error interface accessors for the SDK. |
awsutil | |
client | |
metadata | |
corehandlers | |
credentials | Package credentials provides credential retrieval and management The Credentials is the primary method of getting access to and managing credentials Values. |
ec2rolecreds | |
endpointcreds | Package endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint. |
stscreds | Package stscreds are credential Providers to retrieve STS AWS credentials. |
defaults | Package defaults is a collection of helpers to retrieve the SDK's default configuration and handlers. |
ec2metadata | Package ec2metadata provides the client for making API calls to the EC2 Metadata service. |
endpoints | Package endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions. |
request | |
session | Package session provides configuration for the SDK's service clients. |
signer | |
v4 | Package v4 implements signing for AWS V4 signer Provides request signing for request that need to be signed with AWS V4 Signatures. |
awsmigrate | |
awsmigrate-renamer | |
gen | |
rename | |
awstesting | |
cmd | |
bucket_cleanup | |
integration | Package integration performs initialization and validation for integration tests. |
customizations | |
s3 | |
s3crypto | Package s3crypto provides gucumber integration tests support. |
s3manager | |
smoke | Package smoke contains shared step definitions that are used across integration tests |
acm | Package acm provides gucumber integration tests support. |
apigateway | Package apigateway provides gucumber integration tests support. |
applicationdiscoveryservice | Package applicationdiscoveryservice provides gucumber integration tests support. |
autoscaling | Package autoscaling provides gucumber integration tests support. |
cloudformation | Package cloudformation provides gucumber integration tests support. |
cloudfront | Package cloudfront provides gucumber integration tests support. |
cloudhsm | Package cloudhsm provides gucumber integration tests support. |
cloudsearch | Package cloudsearch provides gucumber integration tests support. |
cloudtrail | Package cloudtrail provides gucumber integration tests support. |
cloudwatch | Package cloudwatch provides gucumber integration tests support. |
cloudwatchlogs | Package cloudwatchlogs provides gucumber integration tests support. |
codecommit | Package codecommit provides gucumber integration tests support. |
codedeploy | Package codedeploy provides gucumber integration tests support. |
codepipeline | Package codepipeline provides gucumber integration tests support. |
cognitoidentity | Package cognitoidentity provides gucumber integration tests support. |
cognitosync | Package cognitosync provides gucumber integration tests support. |
configservice | Package configservice provides gucumber integration tests support. |
datapipeline | Package datapipeline provides gucumber integration tests support. |
devicefarm | Package devicefarm provides gucumber integration tests support. |
directconnect | Package directconnect provides gucumber integration tests support. |
directoryservice | Package directoryservice provides gucumber integration tests support. |
dynamodb | Package dynamodb provides gucumber integration tests support. |
dynamodbstreams | Package dynamodbstreams provides gucumber integration tests support. |
ec2 | Package ec2 provides gucumber integration tests support. |
ecs | Package ecs provides gucumber integration tests support. |
efs | Package efs provides gucumber integration tests support. |
elasticache | Package elasticache provides gucumber integration tests support. |
elasticbeanstalk | Package elasticbeanstalk provides gucumber integration tests support. |
elasticloadbalancing | Package elasticloadbalancing provides gucumber integration tests support. |
elastictranscoder | Package elastictranscoder provides gucumber integration tests support. |
emr | Package emr provides gucumber integration tests support. |
es | Package es provides gucumber integration tests support. |
glacier | Package glacier provides gucumber integration tests support. |
iam | Package iam provides gucumber integration tests support. |
iotdataplane | Package iotdataplane provides gucumber integration tests support. |
kinesis | Package kinesis provides gucumber integration tests support. |
kms | Package kms provides gucumber integration tests support. |
lambda | Package lambda provides gucumber integration tests support. |
machinelearning | Package machinelearning provides gucumber integration tests support. |
opsworks | Package opsworks provides gucumber integration tests support. |
rds | Package rds provides gucumber integration tests support. |
redshift | Package redshift provides gucumber integration tests support. |
route53 | Package route53 provides gucumber integration tests support. |
route53domains | Package route53domains provides gucumber integration tests support. |
ses | Package ses provides gucumber integration tests support. |
simpledb | Package simpledb provides gucumber integration tests support. |
sns | Package sns provides gucumber integration tests support. |
sqs | Package sqs provides gucumber integration tests support. |
ssm | Package ssm provides gucumber integration tests support. |
storagegateway | Package storagegateway provides gucumber integration tests support. |
sts | Package sts provides gucumber integration tests support. |
support | Package support provides gucumber integration tests support. |
swf | Package swf provides gucumber integration tests support. |
waf | Package waf provides gucumber integration tests support. |
workspaces | Package workspaces provides gucumber integration tests support. |
mock | |
performance | Package performance provides gucumber integration tests support. |
unit | Package unit performs initialization and validation for unit tests |
example | |
aws | |
endpoints | |
customEndpoint | |
enumEndpoints | |
request | |
handleServiceErrorCodes | |
withContext | |
service | |
cloudfront | |
signCookies | |
dynamodb | |
scanItems | |
unitTest | Package unitTest demonstrates how to unit test, without needing to pass a connector to every function, code that uses DynamoDB. |
ec2 | |
filterInstances | |
rds | |
rdsutils | |
authentication | |
s3 | |
concatObjects | |
listObjects | |
listObjectsConcurrently | |
presignURL | |
client | |
server | |
putObjectAcl | |
sqs | |
mockingClientsForTests | |
models | |
endpoints | Package endpoints contains the models for endpoints that should be used to generate endpoint definition files for the SDK. |
protocol_tests | |
private | |
model | |
api | Package api represents API abstractions for rendering service generated files. |
cli | |
api-info | |
gen-api | Command aws-gen-gocli parses a JSON description of an AWS API and generates a Go file containing a client for the API. |
gen-endpoints | Command gen-endpoints parses a JSON description of the AWS endpoint discovery logic and generates a Go file which returns an endpoint. |
protocol | |
ec2query | Package ec2query provides serialization of AWS EC2 requests and responses. |
json | |
jsonutil | Package jsonutil provides JSON serialization of AWS requests and responses. |
jsonrpc | Package jsonrpc provides JSON RPC utilities for serialization of AWS requests and responses. |
query | Package query provides serialization of AWS query requests, and responses. |
queryutil | |
rest | Package rest provides RESTful serialization of AWS requests and responses. |
restjson | Package restjson provides RESTful JSON serialization of AWS requests and responses. |
restxml | Package restxml provides RESTful XML serialization of AWS requests and responses. |
xml | |
xmlutil | Package xmlutil provides XML serialization of AWS requests and responses. |
signer | |
v2 | |
util | |
service | Package service contains automatically generated AWS clients. |
acm | Package acm provides the client and types for making API requests to AWS Certificate Manager. |
acmiface | Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code. |
apigateway | Package apigateway provides the client and types for making API requests to Amazon API Gateway. |
apigatewayiface | Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code. |
applicationautoscaling | Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling. |
applicationautoscalingiface | Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code. |
applicationdiscoveryservice | Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service. |
applicationdiscoveryserviceiface | Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code. |
appstream | Package appstream provides the client and types for making API requests to Amazon AppStream. |
appstreamiface | Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code. |
athena | Package athena provides the client and types for making API requests to Amazon Athena. |
athenaiface | Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code. |
autoscaling | Package autoscaling provides the client and types for making API requests to Auto Scaling. |
autoscalingiface | Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code. |
batch | Package batch provides the client and types for making API requests to AWS Batch. |
batchiface | Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code. |
budgets | Package budgets provides the client and types for making API requests to AWS Budgets. |
budgetsiface | Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code. |
clouddirectory | Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory. |
clouddirectoryiface | Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code. |
cloudformation | Package cloudformation provides the client and types for making API requests to AWS CloudFormation. |
cloudformationiface | Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code. |
cloudfront | Package cloudfront provides the client and types for making API requests to Amazon CloudFront. |
cloudfrontiface | Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code. |
sign | Package sign provides utilities to generate signed URLs for Amazon CloudFront. |
cloudhsm | Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM. |
cloudhsmiface | Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code. |
cloudsearch | Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch. |
cloudsearchiface | Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code. |
cloudsearchdomain | Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain. |
cloudsearchdomainiface | Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code. |
cloudtrail | Package cloudtrail provides the client and types for making API requests to AWS CloudTrail. |
cloudtrailiface | Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code. |
cloudwatch | Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch. |
cloudwatchiface | Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code. |
cloudwatchevents | Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events. |
cloudwatcheventsiface | Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code. |
cloudwatchlogs | Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs. |
cloudwatchlogsiface | Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code. |
codebuild | Package codebuild provides the client and types for making API requests to AWS CodeBuild. |
codebuildiface | Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code. |
codecommit | Package codecommit provides the client and types for making API requests to AWS CodeCommit. |
codecommitiface | Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code. |
codedeploy | Package codedeploy provides the client and types for making API requests to AWS CodeDeploy. |
codedeployiface | Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code. |
codepipeline | Package codepipeline provides the client and types for making API requests to AWS CodePipeline. |
codepipelineiface | Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code. |
codestar | Package codestar provides the client and types for making API requests to AWS CodeStar. |
codestariface | Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code. |
cognitoidentity | Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity. |
cognitoidentityiface | Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code. |
cognitoidentityprovider | Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider. |
cognitoidentityprovideriface | Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code. |
cognitosync | Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync. |
cognitosynciface | Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code. |
configservice | Package configservice provides the client and types for making API requests to AWS Config. |
configserviceiface | Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code. |
costandusagereportservice | Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service. |
costandusagereportserviceiface | Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code. |
databasemigrationservice | Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service. |
databasemigrationserviceiface | Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code. |
datapipeline | Package datapipeline provides the client and types for making API requests to AWS Data Pipeline. |
datapipelineiface | Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code. |
devicefarm | Package devicefarm provides the client and types for making API requests to AWS Device Farm. |
devicefarmiface | Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code. |
directconnect | Package directconnect provides the client and types for making API requests to AWS Direct Connect. |
directconnectiface | Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code. |
directoryservice | Package directoryservice provides the client and types for making API requests to AWS Directory Service. |
directoryserviceiface | Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code. |
dynamodb | Package dynamodb provides the client and types for making API requests to Amazon DynamoDB. |
dynamodbattribute | Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues. |
dynamodbiface | Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code. |
dynamodbstreams | Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams. |
dynamodbstreamsiface | Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code. |
ec2 | Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud. |
ec2iface | Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code. |
ecr | Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry. |
ecriface | Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code. |
ecs | Package ecs provides the client and types for making API requests to Amazon EC2 Container Service. |
ecsiface | Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code. |
efs | Package efs provides the client and types for making API requests to Amazon Elastic File System. |
efsiface | Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code. |
elasticache | Package elasticache provides the client and types for making API requests to Amazon ElastiCache. |
elasticacheiface | Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code. |
elasticbeanstalk | Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk. |
elasticbeanstalkiface | Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code. |
elasticsearchservice | Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service. |
elasticsearchserviceiface | Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code. |
elastictranscoder | Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder. |
elastictranscoderiface | Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code. |
elb | Package elb provides the client and types for making API requests to Elastic Load Balancing. |
elbiface | Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
elbv2 | Package elbv2 provides the client and types for making API requests to Elastic Load Balancing. |
elbv2iface | Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
emr | Package emr provides the client and types for making API requests to Amazon Elastic MapReduce. |
emriface | Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code. |
firehose | Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose. |
firehoseiface | Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code. |
gamelift | Package gamelift provides the client and types for making API requests to Amazon GameLift. |
gameliftiface | Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code. |
glacier | Package glacier provides the client and types for making API requests to Amazon Glacier. |
glacieriface | Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code. |
greengrass | Package greengrass provides the client and types for making API requests to AWS Greengrass. |
greengrassiface | Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code. |
health | Package health provides the client and types for making API requests to AWS Health APIs and Notifications. |
healthiface | Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code. |
iam | Package iam provides the client and types for making API requests to AWS Identity and Access Management. |
iamiface | Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code. |
inspector | Package inspector provides the client and types for making API requests to Amazon Inspector. |
inspectoriface | Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code. |
iot | Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected things (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud. |
iotiface | Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code. |
iotdataplane | Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane. |
iotdataplaneiface | Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code. |
kinesis | Package kinesis provides the client and types for making API requests to Amazon Kinesis. |
kinesisiface | Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code. |
kinesisanalytics | Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics. |
kinesisanalyticsiface | Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. |
kms | Package kms provides the client and types for making API requests to AWS Key Management Service. |
kmsiface | Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code. |
lambda | Package lambda provides the client and types for making API requests to AWS Lambda. |
lambdaiface | Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code. |
lexmodelbuildingservice | Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service. |
lexmodelbuildingserviceiface | Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code. |
lexruntimeservice | Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service. |
lexruntimeserviceiface | Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code. |
lightsail | Package lightsail provides the client and types for making API requests to Amazon Lightsail. |
lightsailiface | Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code. |
machinelearning | Package machinelearning provides the client and types for making API requests to Amazon Machine Learning. |
machinelearningiface | Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code. |
marketplacecommerceanalytics | Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics. |
marketplacecommerceanalyticsiface | Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code. |
marketplaceentitlementservice | Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service. |
marketplaceentitlementserviceiface | Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code. |
marketplacemetering | Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering. |
marketplacemeteringiface | Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code. |
mobileanalytics | Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics. |
mobileanalyticsiface | Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code. |
mturk | Package mturk provides the client and types for making API requests to Amazon Mechanical Turk. |
mturkiface | Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code. |
opsworks | Package opsworks provides the client and types for making API requests to AWS OpsWorks. |
opsworksiface | Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code. |
opsworkscm | Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate. |
opsworkscmiface | Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code. |
organizations | Package organizations provides the client and types for making API requests to AWS Organizations. |
organizationsiface | Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code. |
pinpoint | Package pinpoint provides the client and types for making API requests to Amazon Pinpoint. |
pinpointiface | Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code. |
polly | Package polly provides the client and types for making API requests to Amazon Polly. |
pollyiface | Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code. |
rds | Package rds provides the client and types for making API requests to Amazon Relational Database Service. |
rdsiface | Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code. |
rdsutils | |
redshift | Package redshift provides the client and types for making API requests to Amazon Redshift. |
redshiftiface | Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code. |
rekognition | Package rekognition provides the client and types for making API requests to Amazon Rekognition. |
rekognitioniface | Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code. |
resourcegroupstaggingapi | Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API. |
resourcegroupstaggingapiiface | Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code. |
route53 | Package route53 provides the client and types for making API requests to Amazon Route 53. |
route53iface | Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code. |
route53domains | Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains. |
route53domainsiface | Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code. |
s3 | Package s3 provides the client and types for making API requests to Amazon Simple Storage Service. |
s3crypto | Package s3crypto provides encryption to S3 using KMS and AES GCM. |
s3iface | Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code. |
s3manager | Package s3manager provides utilities to upload and download objects from S3 concurrently. |
s3manageriface | Package s3manageriface provides an interface for the s3manager package |
servicecatalog | Package servicecatalog provides the client and types for making API requests to AWS Service Catalog. |
servicecatalogiface | Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code. |
ses | Package ses provides the client and types for making API requests to Amazon Simple Email Service. |
sesiface | Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code. |
sfn | Package sfn provides the client and types for making API requests to AWS Step Functions. |
sfniface | Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code. |
shield | Package shield provides the client and types for making API requests to AWS Shield. |
shieldiface | Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code. |
simpledb | Package simpledb provides the client and types for making API requests to Amazon SimpleDB. |
simpledbiface | Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code. |
sms | Package sms provides the client and types for making API requests to AWS Server Migration Service. |
smsiface | Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code. |
snowball | Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball. |
snowballiface | Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code. |
sns | Package sns provides the client and types for making API requests to Amazon Simple Notification Service. |
snsiface | Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code. |
sqs | Package sqs provides the client and types for making API requests to Amazon Simple Queue Service. |
sqsiface | Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code. |
ssm | Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM). |
ssmiface | Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code. |
storagegateway | Package storagegateway provides the client and types for making API requests to AWS Storage Gateway. |
storagegatewayiface | Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code. |
sts | Package sts provides the client and types for making API requests to AWS Security Token Service. |
stsiface | Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code. |
support | Package support provides the client and types for making API requests to AWS Support. |
supportiface | Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code. |
swf | Package swf provides the client and types for making API requests to Amazon Simple Workflow Service. |
swfiface | Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code. |
waf | Package waf provides the client and types for making API requests to AWS WAF. |
wafiface | Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code. |
wafregional | Package wafregional provides the client and types for making API requests to AWS WAF Regional. |
wafregionaliface | Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code. |
workdocs | Package workdocs provides the client and types for making API requests to Amazon WorkDocs. |
workdocsiface | Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code. |
workspaces | Package workspaces provides the client and types for making API requests to Amazon WorkSpaces. |
workspacesiface | Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code. |
xray | Package xray provides the client and types for making API requests to AWS X-Ray. |
xrayiface | Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code. |
beorn7 | |
perks | |
histogram | Package histogram provides a Go implementation of BigML's histogram package for Clojure/Java. |
quantile | Package quantile computes approximate quantiles over an unbounded data stream within low memory and CPU bounds. |
topk | |
bradfitz | |
gomemcache | |
memcache | Package memcache provides a client for the memcached cache server. |
coreos | |
etcd | Package main is a simple wrapper of the real etcd entrypoint package (located at github.com/coreos/etcd/etcdmain) to ensure that etcd is still "go getable"; e.g. |
alarm | Package alarm manages health status alarms in etcd. |
auth | Package auth provides client role authentication for accessing keys in etcd. |
authpb | Package authpb is a generated protocol buffer package. |
client | Package client provides bindings for the etcd APIs. |
integration | Package integration implements tests built upon embedded etcd, focusing on the correctness of the etcd v2 client. |
clientv3 | Package clientv3 implements the official Go etcd client for v3. |
clientv3util | Package clientv3util contains utility functions derived from clientv3. |
concurrency | Package concurrency implements concurrency operations on top of etcd such as distributed locks, barriers, and elections. |
integration | Package integration implements tests built upon embedded etcd, and focuses on correctness of etcd client. |
mirror | Package mirror implements etcd mirroring operations. |
namespace | Package namespace is a clientv3 wrapper that translates all keys to begin with a given prefix. |
naming | Package naming provides an etcd-backed gRPC resolver for discovering gRPC services. |
yaml | Package yaml handles yaml-formatted clientv3 configuration data. |
cmd | |
compactor | Package compactor implements automated policies for compacting etcd's mvcc storage. |
contrib | |
raftexample | raftexample is a simple KV store using the raft and rafthttp libraries. |
recipes | Package recipe contains experimental client-side distributed synchronization primitives. |
systemd | |
etcd2-backup-coreos | |
discovery | Package discovery provides an implementation of the cluster discovery that is used by etcd. |
e2e | Package e2e implements tests built upon etcd binaries, and focus on end-to-end testing. |
embed | Package embed provides bindings for embedding an etcd server in a program. |
error | Package error describes errors in etcd project. |
etcdctl | etcdctl is a command line application that controls etcd. |
ctlv2 | Package ctlv2 contains the main entry point for the etcdctl for v2 API. |
command | Package command is a set of libraries for etcdctl commands. |
ctlv3 | Package ctlv3 contains the main entry point for the etcdctl for v3 API. |
command | Package command is a set of libraries for etcd v3 commands. |
etcdmain | Package etcdmain contains the main entry point for the etcd binary. |
etcdserver | Package etcdserver defines how etcd servers interact and store their states. |
api | Package api manages the capabilities and features that are exposed to clients by the etcd cluster. |
v2http | Package v2http provides etcd client and server implementations. |
httptypes | Package httptypes defines how etcd's HTTP API entities are serialized to and deserialized from JSON. |
v3client | Package v3client provides clientv3 interfaces from an etcdserver. |
v3election | Package v3election provides a v3 election service from an etcdserver. |
v3electionpb | Package v3electionpb is a generated protocol buffer package. |
gw | Package v3electionpb is a reverse proxy. |
v3lock | Package v3lock provides a v3 locking service from an etcdserver. |
v3lockpb | Package v3lockpb is a generated protocol buffer package. |
gw | Package v3lockpb is a reverse proxy. |
v3rpc | Package v3rpc implements etcd v3 RPC system based on gRPC. |
rpctypes | Package rpctypes has types and values shared by the etcd server and client for v3 RPC interaction. |
auth | Package auth implements etcd authentication. |
etcdserverpb | Package etcdserverpb is a generated protocol buffer package. |
gw | Package etcdserverpb is a reverse proxy. |
membership | Package membership describes individual etcd members and clusters of members. |
stats | Package stats defines a standard interface for etcd cluster statistics. |
integration | Package integration implements tests built upon embedded etcd, and focus on etcd correctness. |
lease | Package lease provides an interface and implemetation for time-limited leases over arbitrary resources. |
leasehttp | Package leasehttp serves lease renewals made through HTTP requests. |
leasepb | Package leasepb is a generated protocol buffer package. |
mvcc | Package mvcc defines etcd's stable MVCC storage. |
backend | Package backend defines a standard interface for etcd's backend MVCC storage. |
mvccpb | Package mvccpb is a generated protocol buffer package. |
pkg | |
adt | Package adt implements useful abstract data types. |
contention | Package contention provides facilities for detecting system contention. |
cors | Package cors handles cross-origin HTTP requests (CORS). |
cpuutil | Package cpuutil provides facilities for detecting cpu-specific features. |
crc | Package crc provides utility function for cyclic redundancy check algorithms. |
debugutil | Package debugutil includes utility functions for debugging. |
expect | Package expect implements a small expect-style interface |
fileutil | Package fileutil implements utility functions related to files and paths. |
flags | Package flags implements command-line flag parsing. |
httputil | Package httputil provides HTTP utility functions. |
idutil | Package idutil implements utility functions for generating unique, randomized ids. |
ioutil | Package ioutil implements I/O utility functions. |
logutil | Package logutil includes utilities to facilitate logging. |
mock | |
mockstorage | Package mockstorage provides mock implementations for etcdserver's storage interface. |
mockstore | Package mockstore provides mock structures for the etcd store package. |
mockwait | Package mockwait provides mock implementations for pkg/wait. |
monotime | Package monotime provides a fast monotonic clock source. |
netutil | Package netutil implements network-related utility functions. |
osutil | Package osutil implements operating system-related utility functions. |
pathutil | Package pathutil implements utility functions for handling slash-separated paths. |
pbutil | Package pbutil defines interfaces for handling Protocol Buffer objects. |
report | Package report generates human-readable benchmark reports. |
runtime | Package runtime implements utility functions for runtime systems. |
schedule | Package schedule provides mechanisms and policies for scheduling units of work. |
srv | Package srv looks up DNS SRV records. |
stringutil | Package stringutil exports string utility functions. |
testutil | Package testutil provides test utility functions. |
tlsutil | Package tlsutil provides utility functions for handling TLS. |
transport | Package transport implements various HTTP transport utilities based on Go net package. |
types | Package types declares various data types and implements type-checking functions. |
wait | Package wait provides utility functions for polling, listening using Go channel. |
proxy | |
grpcproxy | Package grpcproxy is an OSI level 7 proxy for etcd v3 API requests. |
adapter | Package adapter provides gRPC adapters between client and server gRPC interfaces without needing to go through a gRPC connection. |
cache | Package cache exports functionality for efficiently caching and mapping `RangeRequest`s to corresponding `RangeResponse`s. |
httpproxy | Package httpproxy implements etcd httpproxy. |
tcpproxy | Package tcpproxy is an OSI level 4 proxy for routing etcd clients to etcd servers. |
raft | Package raft sends and receives messages in the Protocol Buffer format defined in the raftpb package. |
raftpb | Package raftpb is a generated protocol buffer package. |
rafttest | Package rafttest provides functional tests for etcd's raft implementation. |
rafthttp | Package rafthttp implements HTTP transportation layer for etcd/raft pkg. |
snap | Package snap stores raft nodes' states with snapshots. |
snappb | Package snappb is a generated protocol buffer package. |
store | Package store defines etcd's in-memory key/value store. |
tools | |
benchmark | benchmark is a program for benchmarking etcd v3 API performance. |
cmd | Package cmd implements individual benchmark commands for the benchmark utility. |
etcd-dump-db | etcd-dump-db inspects etcd db files. |
etcd-dump-logs | etcd-dump-logs is a program for analyzing etcd server write ahead logs. |
functional-tester | |
etcd-agent | etcd-agent is a daemon for controlling an etcd process via HTTP RPC. |
client | Package client provides a client implementation to control an etcd-agent. |
etcd-runner | etcd-runner is a program for testing etcd clientv3 features against a fault injected cluster. |
command | Package command implements individual etcd-runner commands for the etcd-runner utility. |
etcd-tester | etcd-tester is a single controller for all etcd-agents to manage an etcd cluster and simulate failures. |
local-tester | |
bridge | Package main is the entry point for the local tester network bridge. |
version | Package version implements etcd version parsing and contains latest version information. |
wal | Package wal provides an implementation of a write ahead log that is used by etcd. |
walpb | Package walpb is a generated protocol buffer package. |
go-semver | |
semver | Semantic Versions http://semver.org |
davecgh | |
go-spew | |
spew | Package spew implements a deep pretty printer for Go data structures to aid in debugging. |
denisenkom | |
go-mssqldb | package mssql implements the TDS protocol used to connect to MS SQL Server (sqlserver) database servers. |
batch | bach splits a single script containing multiple batches separated by a keyword into multiple scripts. |
examples | |
bulk | |
simple | |
tsql | |
dgrijalva | |
jwt-go | Package jwt is a Go implementation of JSON Web Tokens: http://self-issued.info/docs/draft-jones-json-web-token.html See README.md for more info. |
cmd | |
jwt | A useful example app. |
request | Utility package for extracting JWT tokens from HTTP requests. |
test | |
eapache | |
go-resiliency | |
batcher | Package batcher implements the batching resiliency pattern for Go. |
breaker | Package breaker implements the circuit-breaker resiliency pattern for Go. |
deadline | Package deadline implements the deadline (also known as "timeout") resiliency pattern for Go. |
retrier | Package retrier implements the "retriable" resiliency pattern for Go. |
semaphore | Package semaphore implements the semaphore resiliency pattern for Go. |
go-xerial-snappy | |
queue | Package queue provides a fast, ring-buffer queue based on the version suggested by Dariusz GΓ³recki. |
go-kit | |
kit | |
auth | |
jwt | |
circuitbreaker | Package circuitbreaker implements the circuit breaker pattern. |
endpoint | Package endpoint defines an abstraction for RPCs. |
log | Package log provides a structured logger. |
deprecated_levels | |
level | Package level implements leveled logging on top of package log. |
term | Package term provides tools for logging to a terminal. |
metrics | Package metrics provides a framework for application instrumentation. |
discard | Package discard provides a no-op metrics backend. |
dogstatsd | Package dogstatsd provides a DogStatsD backend for package metrics. |
expvar | Package expvar provides expvar backends for metrics. |
generic | Package generic implements generic versions of each of the metric types. |
graphite | Package graphite provides a Graphite backend for metrics. |
influx | Package influx provides an InfluxDB implementation for metrics. |
multi | Package multi provides adapters that send observations to multiple metrics simultaneously. |
pcp | |
prometheus | Package prometheus provides Prometheus implementations for metrics. |
provider | Package provider provides a factory-like abstraction for metrics backends. |
statsd | Package statsd provides a StatsD backend for package metrics. |
teststat | Package teststat provides helpers for testing metrics backends. |
ratelimit | |
sd | Package sd provides utilities related to service discovery. |
cache | |
consul | Package consul provides subscriber and registrar implementations for Consul. |
dnssrv | Package dnssrv provides a subscriber implementation for DNS SRV records. |
etcd | Package etcd provides a Subscriber and Registrar implementation for etcd. |
lb | Package lb implements the client-side load balancer pattern. |
zk | Package zk provides subscriber and registrar implementations for ZooKeeper. |
tracing | Package tracing provides helpers and bindings for distributed tracing. |
opentracing | Package opentracing provides Go kit integration to the OpenTracing project. |
transport | Package transport contains bindings to concrete transports. |
grpc | Package grpc provides a gRPC binding for endpoints. |
http | Package http provides a general purpose HTTP binding for endpoints. |
httprp | Package httprp provides an HTTP reverse-proxy transport. |
util | |
conn | Package conn provides utilities related to connections. |
go-log | |
log | Package log provides a log interface |
appengine | |
fmt | |
log | |
logrus | |
go-logfmt | |
logfmt | Package logfmt implements utilities to marshal and unmarshal data in the logfmt format. |
go-redis | |
redis | Package redis implements a Redis client. |
go-sql-driver | |
mysql | Package mysql provides a MySQL driver for Go's database/sql package The driver should be used via the database/sql package: import "database/sql" import _ "github.com/go-sql-driver/mysql" db, err := sql.Open("mysql", "user:password@/dbname") See https://github.com/go-sql-driver/mysql#usage for details |
go-stack | |
stack | Package stack implements utilities to capture, manipulate, and format call stacks. |
gocql | |
gocql | Package gocql implements a fast and robust Cassandra driver for the Go programming language. |
gogo | |
protobuf | |
codec | |
gogoproto | Package gogoproto provides extensions for protocol buffers to achieve: - fast marshalling and unmarshalling. |
gogoreplace | |
io | |
jsonpb | Package jsonpb provides marshaling and unmarshaling between protocol buffers and JSON. |
jsonpb_test_proto | Package jsonpb is a generated protocol buffer package. |
plugin | |
compare | |
defaultcheck | The defaultcheck plugin is used to check whether nullable is not used incorrectly. |
description | The description (experimental) plugin generates a Description method for each message. |
embedcheck | The embedcheck plugin is used to check whether embed is not used incorrectly. |
enumstringer | The enumstringer (experimental) plugin generates a String method for each enum. |
equal | The equal plugin generates an Equal and a VerboseEqual method for each message. |
face | The face plugin generates a function will be generated which can convert a structure which satisfies an interface (face) to the specified structure. |
gostring | The gostring plugin generates a GoString method for each message. |
marshalto | The marshalto plugin generates a Marshal and MarshalTo method for each message. |
oneofcheck | The oneofcheck plugin is used to check whether oneof is not used incorrectly. |
populate | The populate plugin generates a NewPopulated function. |
size | The size plugin generates a Size or ProtoSize method for each message. |
stringer | The stringer plugin generates a String method for each message. |
testgen | The testgen plugin generates Test and Benchmark functions for each message. |
union | The onlyone plugin generates code for the onlyone extension. |
unmarshal | The unmarshal plugin generates a Unmarshal method for each message. |
proto | Package proto converts data structures to and from the wire format of protocol buffers. |
proto3_proto | Package proto3_proto is a generated protocol buffer package. |
protoc-gen-combo | |
protoc-gen-gofast | |
protoc-gen-gogo | protoc-gen-go is a plugin for the Google protocol buffer compiler to generate Go code. |
descriptor | Package descriptor provides functions for obtaining protocol buffer descriptors for generated Go types. |
generator | The code generator for the plugin for the Google protocol buffer compiler. |
grpc | Package grpc outputs gRPC service descriptions in Go code. |
plugin | Package plugin_go is a generated protocol buffer package. |
protoc-gen-gogofast | |
protoc-gen-gogofaster | |
protoc-gen-gogoslick | |
protoc-gen-gogotypes | |
protoc-gen-gostring | |
protoc-min-version | |
sortkeys | |
test | Package test is a generated protocol buffer package. |
asymetric-issue125 | Package asym is a generated protocol buffer package. |
casttype | |
combos | |
both | Package casttype is a generated protocol buffer package. |
marshaler | Package casttype is a generated protocol buffer package. |
neither | Package casttype is a generated protocol buffer package. |
unmarshaler | Package casttype is a generated protocol buffer package. |
unsafeboth | Package casttype is a generated protocol buffer package. |
unsafemarshaler | Package casttype is a generated protocol buffer package. |
unsafeunmarshaler | Package casttype is a generated protocol buffer package. |
castvalue | Package castvalue is a generated protocol buffer package. |
combos | |
both | Package castvalue is a generated protocol buffer package. |
marshaler | Package castvalue is a generated protocol buffer package. |
unmarshaler | Package castvalue is a generated protocol buffer package. |
unsafeboth | Package castvalue is a generated protocol buffer package. |
unsafemarshaler | Package castvalue is a generated protocol buffer package. |
unsafeunmarshaler | Package castvalue is a generated protocol buffer package. |
combos | |
both | Package test is a generated protocol buffer package. |
marshaler | Package test is a generated protocol buffer package. |
unmarshaler | Package test is a generated protocol buffer package. |
unsafeboth | Package test is a generated protocol buffer package. |
unsafemarshaler | Package test is a generated protocol buffer package. |
unsafeunmarshaler | Package test is a generated protocol buffer package. |
custom | Package custom contains custom types for test and example purposes. |
custom-dash-type | Package custom contains custom types for test and example purposes. |
custombytesnonstruct | Package custombytesnonstruct is a generated protocol buffer package. |
dashfilename | |
data | Package data is a generated protocol buffer package. |
defaultconflict | |
embedconflict | |
empty-issue70 | Package empty is a generated protocol buffer package. |
enumcustomname | Package enumcustomname is a generated protocol buffer package. |
enumdecl | Package enumdecl is a generated protocol buffer package. |
enumdecl_all | Package enumdeclall is a generated protocol buffer package. |
enumprefix | Package enumprefix is a generated protocol buffer package. |
enumstringer | Package enumstringer is a generated protocol buffer package. |
example | Package test is a generated protocol buffer package. |
filedotname | Package filedotname is a generated protocol buffer package. |
fuzztests | Package fuzztests is a generated protocol buffer package. |
group | Package group is a generated protocol buffer package. |
importdedup | Package importdedup is a generated protocol buffer package. |
subpkg | Package subpkg is a generated protocol buffer package. |
indeximport-issue72 | Package indeximport is a generated protocol buffer package. |
index | Package index is a generated protocol buffer package. |
issue260 | Package issue260 is a generated protocol buffer package. |
issue261 | Package issue261 is a generated protocol buffer package. |
issue262 | Package timefail is a generated protocol buffer package. |
issue34 | Package issue34 is a generated protocol buffer package. |
issue42order | Package issue42 is a generated protocol buffer package. |
issue8 | Package proto is a generated protocol buffer package. |
mapsproto2 | |
combos | |
both | Package proto2_maps is a generated protocol buffer package. |
marshaler | Package proto2_maps is a generated protocol buffer package. |
neither | Package proto2_maps is a generated protocol buffer package. |
unmarshaler | Package proto2_maps is a generated protocol buffer package. |
unsafeboth | Package proto2_maps is a generated protocol buffer package. |
unsafemarshaler | Package proto2_maps is a generated protocol buffer package. |
unsafeunmarshaler | Package proto2_maps is a generated protocol buffer package. |
mixbench | |
moredefaults | Package moredefaults is a generated protocol buffer package. |
nopackage | Package nopackage is a generated protocol buffer package. |
oneof | |
combos | |
both | Package one is a generated protocol buffer package. |
marshaler | Package one is a generated protocol buffer package. |
neither | Package one is a generated protocol buffer package. |
unmarshaler | Package one is a generated protocol buffer package. |
unsafeboth | Package one is a generated protocol buffer package. |
unsafemarshaler | Package one is a generated protocol buffer package. |
unsafeunmarshaler | Package one is a generated protocol buffer package. |
oneof3 | |
combos | |
both | Package one is a generated protocol buffer package. |
marshaler | Package one is a generated protocol buffer package. |
neither | Package one is a generated protocol buffer package. |
unmarshaler | Package one is a generated protocol buffer package. |
unsafeboth | Package one is a generated protocol buffer package. |
unsafemarshaler | Package one is a generated protocol buffer package. |
unsafeunmarshaler | Package one is a generated protocol buffer package. |
oneofembed | Package proto is a generated protocol buffer package. |
packed | Package packed is a generated protocol buffer package. |
proto3extension | Package proto3extension is a generated protocol buffer package. |
protosize | Package protosize is a generated protocol buffer package. |
required | Package required is a generated protocol buffer package. |
sizeunderscore | Package sizeunderscore is a generated protocol buffer package. |
stdtypes | Package stdtypes is a generated protocol buffer package. |
tags | Package tags is a generated protocol buffer package. |
theproto3 | |
combos | |
both | Package theproto3 is a generated protocol buffer package. |
marshaler | Package theproto3 is a generated protocol buffer package. |
neither | Package theproto3 is a generated protocol buffer package. |
unmarshaler | Package theproto3 is a generated protocol buffer package. |
unsafeboth | Package theproto3 is a generated protocol buffer package. |
unsafemarshaler | Package theproto3 is a generated protocol buffer package. |
unsafeunmarshaler | Package theproto3 is a generated protocol buffer package. |
typedecl | Package typedecl is a generated protocol buffer package. |
typedecl_all | Package typedeclall is a generated protocol buffer package. |
types | |
combos | |
both | Package types is a generated protocol buffer package. |
marshaler | Package types is a generated protocol buffer package. |
neither | Package types is a generated protocol buffer package. |
unmarshaler | Package types is a generated protocol buffer package. |
unsafeboth | Package types is a generated protocol buffer package. |
unsafemarshaler | Package types is a generated protocol buffer package. |
unsafeunmarshaler | Package types is a generated protocol buffer package. |
unmarshalmerge | Package unmarshalmerge is a generated protocol buffer package. |
unrecognized | Package unrecognized is a generated protocol buffer package. |
unrecognizedgroup | Package unrecognizedgroup is a generated protocol buffer package. |
types | Package types is a generated protocol buffer package. |
vanity | |
command | |
test | |
fast | Package vanity is a generated protocol buffer package. |
faster | Package vanity is a generated protocol buffer package. |
slick | Package vanity is a generated protocol buffer package. |
version | |
golang | |
glog | Package glog implements logging analogous to the Google-internal C++ INFO/ERROR/V setup. |
lint | Package lint contains a linter for Go source code. |
golint | golint lints the Go source files named on its command line. |
mock | |
gomock | GoMock - a mock framework for Go. |
mock_matcher | |
mockgen | MockGen generates mock implementations of Go interfaces. |
model | Package model contains the data model necessary for generating mock implementations. |
sample | An example package with an interface. |
imp1 | |
imp2 | |
imp3 | |
imp4 | |
mock_user | |
protobuf | |
descriptor | Package descriptor provides functions for obtaining protocol buffer descriptors for generated Go types. |
jsonpb | Package jsonpb provides marshaling and unmarshaling between protocol buffers and JSON. |
jsonpb_test_proto | Package jsonpb is a generated protocol buffer package. |
proto | Package proto converts data structures to and from the wire format of protocol buffers. |
proto3_proto | Package proto3_proto is a generated protocol buffer package. |
protoc-gen-go | protoc-gen-go is a plugin for the Google protocol buffer compiler to generate Go code. |
descriptor | Package descriptor is a generated protocol buffer package. |
generator | The code generator for the plugin for the Google protocol buffer compiler. |
grpc | Package grpc outputs gRPC service descriptions in Go code. |
plugin | Package plugin_go is a generated protocol buffer package. |
ptypes | Package ptypes contains code for interacting with well-known types. |
any | Package any is a generated protocol buffer package. |
duration | Package duration is a generated protocol buffer package. |
empty | Package empty is a generated protocol buffer package. |
struct | Package structpb is a generated protocol buffer package. |
timestamp | Package timestamp is a generated protocol buffer package. |
wrappers | Package wrappers is a generated protocol buffer package. |
snappy | Package snappy implements the snappy block-based compression format. |
uuid | Package uuid generates and inspects UUIDs. |
googleapis | |
gax-go | Package gax contains a set of modules which aid the development of APIs for clients and servers based on gRPC and Google API conventions. |
gorilla | |
mux | Package mux implements a request router and dispatcher. |
websocket | Package websocket implements the WebSocket protocol defined in RFC 6455. |
examples | |
autobahn | Command server is a test server for the Autobahn WebSockets Test Suite. |
chat | |
command | |
echo | |
filewatch | |
hailocab | |
go-hostpool | A Go package to intelligently and flexibly pool among multiple hosts from your Go application. |
hashicorp | |
consul | |
acl | |
api | The /v1/operator/area endpoints are available only in Consul Enterprise and interact with its network area subsystem. |
command | |
agent | |
mock | |
base | |
consul | The snapshot endpoint is a special non-RPC endpoint that supports streaming for taking and restoring snapshots for disaster recovery. |
agent | Package agent provides a logical endpoint for Consul agents in the network. |
prepared_query | |
servers | Package servers provides a Manager interface for Manager managed agent.Server objects. |
state | |
structs | |
ipaddr | |
lib | |
logger | |
snapshot | The archive utilities manage the internal format of a snapshot, which is a tar file with the following contents: meta.json - JSON-encoded snapshot metadata from Raft state.bin - Encoded snapshot data from Raft SHA256SUMS - SHA-256 sums of the above two files The integrity information is automatically created and checked, and a failure there just looks like an error to the caller. |
testrpc | |
testutil | |
retry | Package retry provides support for repeating operations in tests. |
tlsutil | |
types | |
version | |
watch | |
influxdata | |
influxdb | Package influxdb is the root package of InfluxDB, the scalable datastore for metrics, events, and real-time analytics. |
client | Package client implements a now-deprecated client for InfluxDB; use github.com/influxdata/influxdb/client/v2 instead. |
v2 | Package client (v2) is the current official Go client for InfluxDB. |
cmd | Package cmd is the root package of the various command-line utilities for InfluxDB. |
influx | The influx command is a CLI client to InfluxDB. |
cli | Package cli contains the logic of the influx command line client. |
influx_inspect | The influx_inspect command displays detailed information about InfluxDB data files. |
dumptsm | Package dumptsm inspects low-level details about tsm1 files. |
export | Package export exports TSM files into InfluxDB line protocol format. |
help | Package help contains the help for the influx_inspect command. |
report | Package report reports statistics about TSM files. |
verify | Package verify verifies integrity of TSM files. |
influx_stress | Command influx_stress is deprecated; use github.com/influxdata/influx-stress instead. |
influx_tsm | Command influx_tsm converts b1 or bz1 shards (from InfluxDB releases earlier than v0.11) to the current tsm1 format. |
b1 | Package b1 reads data from b1 shards. |
bz1 | Package bz1 reads data from bz1 shards. |
stats | Package stats contains statistics for converting non-TSM shards to TSM. |
tsdb | Pacage tsdb abstracts the various shard types supported by the influx_tsm command. |
influxd | Command influxd is the InfluxDB server. |
backup | Package backup is the backup subcommand for the influxd command. |
help | Package help is the help subcommand of the influxd command. |
restore | Package restore is the restore subcommand for the influxd command, for restoring from a backup. |
run | Package run is the run (default) subcommand for the influxd command. |
coordinator | Package coordinator contains abstractions for writing points, executing statements, and accessing meta data. |
importer | |
v8 | Package v8 contains code for importing data from 0.8 instances of InfluxDB. |
influxql | Package influxql implements a parser for the InfluxDB query language. |
neldermead | Package neldermead is an implementation of the Nelder-Mead optimization method. |
models | Package models implements basic objects used throughout the TICK stack. |
monitor | Package monitor provides a service and associated functionality for InfluxDB to self-monitor internal statistics and diagnostics. |
diagnostics | Package diagnostics provides the diagnostics type so that other packages can provide diagnostics without depending on the monitor package. |
pkg | |
deep | Package deep provides a deep equality check for use in tests. |
escape | Package escape contains utilities for escaping parts of InfluxQL and InfluxDB line protocol. |
limiter | Package limiter provides concurrency limiters. |
pool | Package pool provides pool structures to help reduce garbage collector pressure. |
slices | Package slices contains functions to operate on slices treated as sets. |
services | |
admin | |
statik | |
collectd | Package collectd provides a service for InfluxDB to ingest data via the collectd protocol. |
test_client | |
continuous_querier | Package continuous_querier provides the continuous query service. |
graphite | Package graphite provides a service for InfluxDB to ingest data via the graphite protocol. |
httpd | Package httpd implements the HTTP service and REST API for InfluxDB. |
meta | Package meta provides control over meta data for InfluxDB, such as controlling databases, retention policies, users, etc. |
opentsdb | Package opentsdb provides a service for InfluxDB to ingest data via the opentsdb protocol. |
precreator | Package precreator provides the shard precreation service. |
retention | Package retention provides the retention policy enforcement service. |
snapshotter | Package snapshotter provides the meta snapshot service. |
subscriber | Package subscriber implements the subscriber service to forward incoming data to remote services. |
udp | Package udp provides the UDP input service for InfluxDB. |
stress | |
stress_test_server | |
v2 | |
statement | |
stress_client | |
stressql | |
statement | |
tcp | Package tcp provides a simple multiplexer over TCP. |
tests | |
urlgen | |
toml | Package toml adds support to marshal and unmarshal types not in the official TOML spec. |
tsdb | Package tsdb implements a durable time series database. |
engine | Package engine can be imported to initialize and register all available TSDB engines. |
tsm1 | Package tsm1 provides a TSDB in the Time Structured Merge tree format. |
uuid | Package uuid provides functions to create time-based UUIDs. |
jackc | |
pgx | Package pgx is a PostgreSQL database driver. |
examples | |
chat | |
todo | |
url_shortener | |
stdlib | Package stdlib is the compatibility layer from pgx to database/sql. |
jmoiron | |
sqlx | Package sqlx provides general purpose extensions to database/sql. |
reflectx | Package reflectx implements extensions to the standard reflect lib suitable for implementing marshalling and unmarshalling packages. |
types | |
juju | |
ratelimit | Package ratelimit provides an efficient token bucket implementation that can be used to limit the rate of arbitrary things. |
klauspost | |
compress | |
flate | Package flate implements the DEFLATE compressed data format, described in RFC 1951. |
gzip | Package gzip implements reading and writing of gzip format compressed files, as specified in RFC 1952. |
snappy | Package snappy implements the snappy block-based compression format. |
zip | Package zip provides support for reading and writing ZIP archives. |
zlib | Package zlib implements reading and writing of zlib format compressed data, as specified in RFC 1950. |
cpuid | Package cpuid provides information about the CPU running the current program. |
private | |
crc32 | Package crc32 implements the 32-bit cyclic redundancy check, or CRC-32, checksum. |
lib | |
pq | Package pq is a pure Go Postgres driver for the database/sql package. |
hstore | |
listen_example | Below you will find a self-contained Go program which uses the LISTEN / NOTIFY mechanism to avoid polling the database while waiting for more work to arrive. |
oid | Package oid contains OID constants as defined by the Postgres server. |
lightstep | |
lightstep-tracer-go | |
basictracer | |
cmd | |
benchmark | |
sendspan | |
collectorpb | Package collectorpb is a generated protocol buffer package. |
examples | |
lightstep_thrift | |
lightsteppb | Package lightstep is a generated protocol buffer package. |
thrift_0_9_2 | |
lib | |
go | |
thrift | |
thrift_rpc | |
mattn | |
go-oci8 | |
matttproud | |
golang_protobuf_extensions | |
ext | Package ext moved to a new location: github.com/matttproud/golang_protobuf_extensions/pbutil. |
pbtest | Package pbtest is deleted for the time being, because upstream Protocol Buffer 3 may have rendered quick.Value-based blackbox generation impossible. |
pbutil | Package pbutil provides record length-delimited Protocol Buffer streaming. |
micro | |
cli | Package cli provides a minimal framework for creating and organizing command line Go applications. |
altsrc | |
go-log | |
go-micro | Package micro is a pluggable RPC framework for microservices |
broker | Package broker is an interface used for asynchronous messaging |
codec | |
json | |
noop | |
http | |
mock | |
client | Package client is an interface for an RPC client |
mock | |
rpc | |
cmd | Package cmd is an interface for parsing the command line |
codec | Package codec is an interface for encoding messages |
jsonrpc | |
protorpc | Package proto is a generated protocol buffer package. |
errors | Package errors provides a way to return detailed information for an RPC request error. |
metadata | Package metadata is a way of defining message headers |
registry | Package registry is an interface for service discovery |
consul | |
mdns | |
mock | |
selector | Package selector is a way to load balance service nodes |
cache | |
server | Package server is an interface for a micro server |
debug | |
proto | Package debug is a generated protocol buffer package. |
mock | |
rpc | |
transport | Package is an interface for synchronous communication |
codec | |
json | |
noop | |
http | |
mock | |
mdns | |
examples | |
client | |
service | |
misc | |
lib | |
addr | |
net | |
tls | |
miekg | |
dns | Package dns implements a full featured interface to the Domain Name System. |
dnsutil | Package dnsutil contains higher-level methods useful with the dns package. |
idn | Package idn implements encoding from and to punycode as speficied by RFC 3492. |
mitchellh | |
hashstructure | |
onsi | |
ginkgo | Ginkgo is a BDD-style testing framework for Golang The godoc documentation describes Ginkgo's API. |
config | Ginkgo accepts a number of configuration options. |
extensions | |
table | |
ginkgo | The Ginkgo CLI The Ginkgo CLI is fully documented [here](http://onsi.github.io/ginkgo/#the_ginkgo_cli) You can also learn more by running: ginkgo help Here are some of the more commonly used commands: To install: go install github.com/onsi/ginkgo/ginkgo To run tests: ginkgo To run tests in all subdirectories: ginkgo -r To run tests in particular packages: ginkgo <flags> /path/to/package /path/to/another/package To pass arguments/flags to your tests: ginkgo <flags> <packages> -- <pass-throughs> To run tests in parallel ginkgo -p this will automatically detect the optimal number of nodes to use. |
convert | |
interrupthandler | |
nodot | |
testrunner | |
testsuite | |
watch | |
integration | |
reporters | Ginkgo's Default Reporter A number of command line flags are available to tweak Ginkgo's default output. |
stenographer | |
support | |
go-colorable | |
go-isatty | Package isatty implements interface to isatty |
types | |
gomega | Gomega is the Ginkgo BDD-style testing framework's preferred matcher library. |
format | Gomega's format package pretty-prints objects. |
gbytes | Package gbytes provides a buffer that supports incrementally detecting input. |
gexec | Package gexec provides support for testing external processes. |
ghttp | Package ghttp supports testing HTTP clients by providing a test server (simply a thin wrapper around httptest's server) that supports registering multiple handlers. |
protobuf | Package protobuf is a generated protocol buffer package. |
gstruct | |
errors | |
matchers | Gomega matchers This package implements the Gomega matchers and does not typically need to be imported. |
support | |
goraph | |
bipartitegraph | |
edge | |
node | |
util | |
types | |
opentracing | |
basictracer-go | |
events | |
examples | |
dapperish | |
wire | Package wire is a generated protocol buffer package. |
opentracing-go | |
ext | |
log | |
mocktracer | |
openzipkin | |
zipkin-go-opentracing | |
events | |
flag | |
types | |
wire | Package wire is a generated protocol buffer package. |
pborman | |
uuid | The uuid package generates and inspects UUIDs. |
performancecopilot | |
speed | Package speed implements a golang client for the Performance Co-Pilot instrumentation API. |
bytewriter | Package bytewriter implements writers that support concurrent writing within a fixed length block initially tried to use bytes.Buffer but the main restriction with that is that it does not allow the freedom to move around in the buffer. |
examples | |
acme | A golang implementation of the acme factory examples from python and Java APIs The python implementation is in mmv.py in PCP core (https://github.com/performancecopilot/pcp/blob/master/src/python/pcp/mmv.py#L21-L70) The Java implementation is in examples in parfait core (https://github.com/performancecopilot/parfait/tree/master/examples/acme) To run the python version of the example that exits do go run examples/acme/main.go To run the java version of the example that runs forever, simply add a --forever flag go run examples/acme/main.go --forever |
basic_histogram | |
http_counter | |
instance_string | |
runtime | |
simple | |
simple_string_metric | |
singleton_counter | |
singleton_string | this example showcases speeds metric inference from strings property |
mmvdump | Package mmvdump implements a go port of the C mmvdump utility included in PCP Core https://github.com/performancecopilot/pcp/blob/master/src/pmdas/mmv/mmvdump.c It has been written for maximum portability with the C equivalent, without having to use cgo or any other ninja stuff the main difference is that the reader is separate from the cli with the reading primarily implemented in mmvdump.go while the cli is implemented in cmd/mmvdump the cli application is completely go gettable and outputs the same things, in mostly the same way as the C cli app, to try it out, ``` go get github.com/performancecopilot/speed/mmvdump/cmd/mmvdump ``` |
cmd | |
mmvdump | |
pierrec | |
lz4 | Package lz4 implements reading and writing lz4 compressed data (a frame), as specified in http://fastcompression.blogspot.fr/2013/04/lz4-streaming-format-final.html, using an io.Reader (decompression) and io.Writer (compression). |
fuzz | |
lz4c | Command line utility for the lz4 package. |
xxHash | |
xxHash32 | Package xxHash32 implements the very fast xxHash hashing algorithm (32 bits version). |
xxHash64 | Package xxHash64 implements the very fast xxHash hashing algorithm (64 bits version). |
pkg | |
errors | Package errors provides simple error handling primitives. |
prometheus | |
client_golang | |
api | Package api provides clients for the HTTP APIs. |
prometheus | |
v1 | Package v1 provides bindings to the Prometheus HTTP API v1: http://prometheus.io/docs/querying/api/ |
examples | |
random | A simple example exposing fictional RPC latencies with different types of random distributions (uniform, normal, and exponential) as Prometheus metrics. |
simple | A minimal example of how to include Prometheus instrumentation. |
prometheus | Package prometheus provides metrics primitives to instrument code for monitoring. |
graphite | Package graphite provides a bridge to push Prometheus metrics to a Graphite server. |
promhttp | Package promhttp provides tooling around HTTP servers and clients. |
push | Package push provides functions to push metrics to a Pushgateway. |
client_model | |
go | Package io_prometheus_client is a generated protocol buffer package. |
common | |
config | |
expfmt | Package expfmt contains tools for reading and writing Prometheus metrics. |
log | |
model | Package model contains common data structures that are shared across Prometheus components and libraries. |
route | |
version | |
procfs | Package procfs provides functions to retrieve system, kernel and process metrics from the pseudo-filesystem proc. |
bcache | Package bcache provides access to statistics exposed by the bcache (Linux block cache). |
sysfs | Package sysfs provides functions to retrieve system and kernel metrics from the pseudo-filesystem sys. |
xfs | Package xfs provides access to statistics exposed by the XFS filesystem. |
rcrowley | |
go-metrics | Go port of Coda Hale's Metrics library <https://github.com/rcrowley/go-metrics> Coda Hale's original work: <https://github.com/codahale/metrics> |
cmd | |
metrics-bench | |
metrics-example | |
never-read | |
exp | Hook go-metrics into expvar on any /debug/metrics request, load all vars from the registry into expvar, and execute regular expvar handler |
librato | |
stathat | Metrics output to StatHat. |
samuel | |
go-zookeeper | |
examples | |
zk | Package zk is a native Go client library for the ZooKeeper orchestration service. |
shopspring | |
decimal | Package decimal implements an arbitrary precision fixed-point decimal. |
sirupsen | |
logrus | Package logrus is a structured logger for Go, completely API compatible with the standard library logger. |
examples | |
basic | |
hook | |
hooks | |
syslog | |
test | The Test package is used for testing logrus. |
sony | |
gobreaker | Package gobreaker implements the Circuit Breaker pattern. |
example | |
streadway | |
handy | Package handy organizes some useful http server handler filters or handlers for reuse. |
accept | Package accept contains filters to reject requests without a specified Accept header with "406 Not Acceptable". |
atomic | Package atomic implements atomic accessors for primitives |
breaker | Package breaker implements a circuit breaker with configurable failure thresholds. |
cors | Package cors contains filters to handle CORS related requests defined from http://www.w3.org/TR/cors/ |
encoding | Package encoding contains Content-Encoding related filters. |
proxy | Package proxy contains a proxying HTTP transport. |
redirect | Package redirect contains filters to handle HTTP and HTTPS redirects |
report | Package report organizes textual reporting from the HTTP context. |
retry | Package retry implements a retrying transport based on a combination of strategies. |
rewrite | Package rewrite contains filters to handle HTTP rewrites |
statsd | Package statsd collects and reports telemetry from http handlers. |
stretchr | |
testify | Package testify is a set of packages that provide many tools for testifying that your code will behave as you intend. |
assert | Package assert provides a set of comprehensive testing tools for use with the normal Go testing system. |
http | Package http DEPRECATED USE net/http/httptest |
mock | Package mock provides a system by which it is possible to mock your objects and verify calls are happening as expected. |
require | Package require implements the same assertions as the `assert` package but stops test execution when a test fails. |
suite | Package suite contains logic for creating testing suite structs and running the methods on those structs as tests. |
tensorflow | |
tensorflow | |
tensorflow | |
go | Package tensorflow is a Go binding to TensorFlow. |
genop | Command genop generates a Go source file with functions for TensorFlow ops. |
op | Package op defines functions for adding TensorFlow operations to a Graph. |
ugorji | |
go | |
codec | High Performance, Feature-Rich Idiomatic Go codec/encoding library for binc, msgpack, cbor, json. |
codecgen | codecgen generates codec.Selfer implementations for a set of types. |
valyala | |
bytebufferpool | Package bytebufferpool implements a pool of byte buffers with anti-fragmentation protection. |
fasthttp | Package fasthttp provides fast HTTP server and client API. |
examples | |
fileserver | Example static file server. |
helloworldserver | |
expvarhandler | Package expvarhandler provides fasthttp-compatible request handler serving expvars. |
fasthttpadaptor | Package fasthttpadaptor provides helper functions for converting net/http request handlers to fasthttp request handlers. |
fasthttputil | Package fasthttputil provides utility functions for fasthttp. |
reuseport | Package reuseport provides TCP net.Listener with SO_REUSEPORT support. |
stackless | Package stackless provides functionality that may save stack space for high number of concurrently running goroutines. |