service - ActiveState ActiveGo 1.8
...

Package service

import "github.com/aws/aws-sdk-go/service"
Overview
Index
Subdirectories

Overview ▾

Package service contains automatically generated AWS clients.

Index ▾

Package files

generate.go

Subdirectories

Name Synopsis
..
acm Package acm provides the client and types for making API requests to AWS Certificate Manager.
acmiface Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
apigateway Package apigateway provides the client and types for making API requests to Amazon API Gateway.
apigatewayiface Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
applicationautoscaling Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
applicationautoscalingiface Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
applicationdiscoveryservice Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
applicationdiscoveryserviceiface Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
appstream Package appstream provides the client and types for making API requests to Amazon AppStream.
appstreamiface Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
athena Package athena provides the client and types for making API requests to Amazon Athena.
athenaiface Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
autoscaling Package autoscaling provides the client and types for making API requests to Auto Scaling.
autoscalingiface Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
batch Package batch provides the client and types for making API requests to AWS Batch.
batchiface Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
budgets Package budgets provides the client and types for making API requests to AWS Budgets.
budgetsiface Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
clouddirectory Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
clouddirectoryiface Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
cloudformation Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
cloudformationiface Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
cloudfront Package cloudfront provides the client and types for making API requests to Amazon CloudFront.
cloudfrontiface Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
sign Package sign provides utilities to generate signed URLs for Amazon CloudFront.
cloudhsm Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM.
cloudhsmiface Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
cloudsearch Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
cloudsearchiface Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
cloudsearchdomain Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
cloudsearchdomainiface Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
cloudtrail Package cloudtrail provides the client and types for making API requests to AWS CloudTrail.
cloudtrailiface Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
cloudwatch Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch.
cloudwatchiface Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
cloudwatchevents Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
cloudwatcheventsiface Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
cloudwatchlogs Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
cloudwatchlogsiface Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
codebuild Package codebuild provides the client and types for making API requests to AWS CodeBuild.
codebuildiface Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
codecommit Package codecommit provides the client and types for making API requests to AWS CodeCommit.
codecommitiface Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
codedeploy Package codedeploy provides the client and types for making API requests to AWS CodeDeploy.
codedeployiface Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
codepipeline Package codepipeline provides the client and types for making API requests to AWS CodePipeline.
codepipelineiface Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
codestar Package codestar provides the client and types for making API requests to AWS CodeStar.
codestariface Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
cognitoidentity Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
cognitoidentityiface Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
cognitoidentityprovider Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
cognitoidentityprovideriface Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
cognitosync Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
cognitosynciface Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
configservice Package configservice provides the client and types for making API requests to AWS Config.
configserviceiface Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
costandusagereportservice Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
costandusagereportserviceiface Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
databasemigrationservice Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
databasemigrationserviceiface Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
datapipeline Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
datapipelineiface Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
devicefarm Package devicefarm provides the client and types for making API requests to AWS Device Farm.
devicefarmiface Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
directconnect Package directconnect provides the client and types for making API requests to AWS Direct Connect.
directconnectiface Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
directoryservice Package directoryservice provides the client and types for making API requests to AWS Directory Service.
directoryserviceiface Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
dynamodb Package dynamodb provides the client and types for making API requests to Amazon DynamoDB.
dynamodbattribute Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
dynamodbiface Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
dynamodbstreams Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
dynamodbstreamsiface Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
ec2 Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.
ec2iface Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
ecr Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry.
ecriface Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
ecs Package ecs provides the client and types for making API requests to Amazon EC2 Container Service.
ecsiface Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
efs Package efs provides the client and types for making API requests to Amazon Elastic File System.
efsiface Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
elasticache Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
elasticacheiface Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
elasticbeanstalk Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.
elasticbeanstalkiface Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
elasticsearchservice Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
elasticsearchserviceiface Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
elastictranscoder Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
elastictranscoderiface Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
elb Package elb provides the client and types for making API requests to Elastic Load Balancing.
elbiface Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
elbv2 Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.
elbv2iface Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
emr Package emr provides the client and types for making API requests to Amazon Elastic MapReduce.
emriface Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
firehose Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose.
firehoseiface Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
gamelift Package gamelift provides the client and types for making API requests to Amazon GameLift.
gameliftiface Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
glacier Package glacier provides the client and types for making API requests to Amazon Glacier.
glacieriface Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
greengrass Package greengrass provides the client and types for making API requests to AWS Greengrass.
greengrassiface Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
health Package health provides the client and types for making API requests to AWS Health APIs and Notifications.
healthiface Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
iam Package iam provides the client and types for making API requests to AWS Identity and Access Management.
iamiface Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
inspector Package inspector provides the client and types for making API requests to Amazon Inspector.
inspectoriface Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
iot Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected things (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud.
iotiface Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
iotdataplane Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
iotdataplaneiface Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
kinesis Package kinesis provides the client and types for making API requests to Amazon Kinesis.
kinesisiface Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
kinesisanalytics Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.
kinesisanalyticsiface Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
kms Package kms provides the client and types for making API requests to AWS Key Management Service.
kmsiface Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
lambda Package lambda provides the client and types for making API requests to AWS Lambda.
lambdaiface Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
lexmodelbuildingservice Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
lexmodelbuildingserviceiface Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
lexruntimeservice Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
lexruntimeserviceiface Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
lightsail Package lightsail provides the client and types for making API requests to Amazon Lightsail.
lightsailiface Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
machinelearning Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
machinelearningiface Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
marketplacecommerceanalytics Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
marketplacecommerceanalyticsiface Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
marketplaceentitlementservice Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
marketplaceentitlementserviceiface Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
marketplacemetering Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
marketplacemeteringiface Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
mobileanalytics Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
mobileanalyticsiface Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
mturk Package mturk provides the client and types for making API requests to Amazon Mechanical Turk.
mturkiface Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
opsworks Package opsworks provides the client and types for making API requests to AWS OpsWorks.
opsworksiface Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
opsworkscm Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate.
opsworkscmiface Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code.
organizations Package organizations provides the client and types for making API requests to AWS Organizations.
organizationsiface Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
pinpoint Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
pinpointiface Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
polly Package polly provides the client and types for making API requests to Amazon Polly.
pollyiface Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
rds Package rds provides the client and types for making API requests to Amazon Relational Database Service.
rdsiface Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
rdsutils
redshift Package redshift provides the client and types for making API requests to Amazon Redshift.
redshiftiface Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
rekognition Package rekognition provides the client and types for making API requests to Amazon Rekognition.
rekognitioniface Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
resourcegroupstaggingapi Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
resourcegroupstaggingapiiface Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
route53 Package route53 provides the client and types for making API requests to Amazon Route 53.
route53iface Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
route53domains Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
route53domainsiface Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
s3 Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.
s3crypto Package s3crypto provides encryption to S3 using KMS and AES GCM.
s3iface Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
s3manager Package s3manager provides utilities to upload and download objects from S3 concurrently.
s3manageriface Package s3manageriface provides an interface for the s3manager package
servicecatalog Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
servicecatalogiface Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
ses Package ses provides the client and types for making API requests to Amazon Simple Email Service.
sesiface Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
sfn Package sfn provides the client and types for making API requests to AWS Step Functions.
sfniface Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
shield Package shield provides the client and types for making API requests to AWS Shield.
shieldiface Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
simpledb Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
simpledbiface Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
sms Package sms provides the client and types for making API requests to AWS Server Migration Service.
smsiface Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
snowball Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball.
snowballiface Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
sns Package sns provides the client and types for making API requests to Amazon Simple Notification Service.
snsiface Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
sqs Package sqs provides the client and types for making API requests to Amazon Simple Queue Service.
sqsiface Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
ssm Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).
ssmiface Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
storagegateway Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
storagegatewayiface Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
sts Package sts provides the client and types for making API requests to AWS Security Token Service.
stsiface Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
support Package support provides the client and types for making API requests to AWS Support.
supportiface Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
swf Package swf provides the client and types for making API requests to Amazon Simple Workflow Service.
swfiface Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
waf Package waf provides the client and types for making API requests to AWS WAF.
wafiface Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
wafregional Package wafregional provides the client and types for making API requests to AWS WAF Regional.
wafregionaliface Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
workdocs Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
workdocsiface Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
workspaces Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
workspacesiface Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
xray Package xray provides the client and types for making API requests to AWS X-Ray.
xrayiface Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.