...
Package service
Overview ▹
Index ▹
Subdirectories
Name | Synopsis |
---|---|
.. | |
acm | Package acm provides the client and types for making API requests to AWS Certificate Manager. |
acmiface | Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code. |
apigateway | Package apigateway provides the client and types for making API requests to Amazon API Gateway. |
apigatewayiface | Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code. |
applicationautoscaling | Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling. |
applicationautoscalingiface | Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code. |
applicationdiscoveryservice | Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service. |
applicationdiscoveryserviceiface | Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code. |
appstream | Package appstream provides the client and types for making API requests to Amazon AppStream. |
appstreamiface | Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code. |
athena | Package athena provides the client and types for making API requests to Amazon Athena. |
athenaiface | Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code. |
autoscaling | Package autoscaling provides the client and types for making API requests to Auto Scaling. |
autoscalingiface | Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code. |
batch | Package batch provides the client and types for making API requests to AWS Batch. |
batchiface | Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code. |
budgets | Package budgets provides the client and types for making API requests to AWS Budgets. |
budgetsiface | Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code. |
clouddirectory | Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory. |
clouddirectoryiface | Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code. |
cloudformation | Package cloudformation provides the client and types for making API requests to AWS CloudFormation. |
cloudformationiface | Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code. |
cloudfront | Package cloudfront provides the client and types for making API requests to Amazon CloudFront. |
cloudfrontiface | Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code. |
sign | Package sign provides utilities to generate signed URLs for Amazon CloudFront. |
cloudhsm | Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM. |
cloudhsmiface | Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code. |
cloudsearch | Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch. |
cloudsearchiface | Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code. |
cloudsearchdomain | Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain. |
cloudsearchdomainiface | Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code. |
cloudtrail | Package cloudtrail provides the client and types for making API requests to AWS CloudTrail. |
cloudtrailiface | Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code. |
cloudwatch | Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch. |
cloudwatchiface | Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code. |
cloudwatchevents | Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events. |
cloudwatcheventsiface | Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code. |
cloudwatchlogs | Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs. |
cloudwatchlogsiface | Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code. |
codebuild | Package codebuild provides the client and types for making API requests to AWS CodeBuild. |
codebuildiface | Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code. |
codecommit | Package codecommit provides the client and types for making API requests to AWS CodeCommit. |
codecommitiface | Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code. |
codedeploy | Package codedeploy provides the client and types for making API requests to AWS CodeDeploy. |
codedeployiface | Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code. |
codepipeline | Package codepipeline provides the client and types for making API requests to AWS CodePipeline. |
codepipelineiface | Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code. |
codestar | Package codestar provides the client and types for making API requests to AWS CodeStar. |
codestariface | Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code. |
cognitoidentity | Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity. |
cognitoidentityiface | Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code. |
cognitoidentityprovider | Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider. |
cognitoidentityprovideriface | Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code. |
cognitosync | Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync. |
cognitosynciface | Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code. |
configservice | Package configservice provides the client and types for making API requests to AWS Config. |
configserviceiface | Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code. |
costandusagereportservice | Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service. |
costandusagereportserviceiface | Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code. |
databasemigrationservice | Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service. |
databasemigrationserviceiface | Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code. |
datapipeline | Package datapipeline provides the client and types for making API requests to AWS Data Pipeline. |
datapipelineiface | Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code. |
devicefarm | Package devicefarm provides the client and types for making API requests to AWS Device Farm. |
devicefarmiface | Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code. |
directconnect | Package directconnect provides the client and types for making API requests to AWS Direct Connect. |
directconnectiface | Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code. |
directoryservice | Package directoryservice provides the client and types for making API requests to AWS Directory Service. |
directoryserviceiface | Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code. |
dynamodb | Package dynamodb provides the client and types for making API requests to Amazon DynamoDB. |
dynamodbattribute | Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues. |
dynamodbiface | Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code. |
dynamodbstreams | Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams. |
dynamodbstreamsiface | Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code. |
ec2 | Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud. |
ec2iface | Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code. |
ecr | Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry. |
ecriface | Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code. |
ecs | Package ecs provides the client and types for making API requests to Amazon EC2 Container Service. |
ecsiface | Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code. |
efs | Package efs provides the client and types for making API requests to Amazon Elastic File System. |
efsiface | Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code. |
elasticache | Package elasticache provides the client and types for making API requests to Amazon ElastiCache. |
elasticacheiface | Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code. |
elasticbeanstalk | Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk. |
elasticbeanstalkiface | Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code. |
elasticsearchservice | Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service. |
elasticsearchserviceiface | Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code. |
elastictranscoder | Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder. |
elastictranscoderiface | Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code. |
elb | Package elb provides the client and types for making API requests to Elastic Load Balancing. |
elbiface | Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
elbv2 | Package elbv2 provides the client and types for making API requests to Elastic Load Balancing. |
elbv2iface | Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
emr | Package emr provides the client and types for making API requests to Amazon Elastic MapReduce. |
emriface | Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code. |
firehose | Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose. |
firehoseiface | Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code. |
gamelift | Package gamelift provides the client and types for making API requests to Amazon GameLift. |
gameliftiface | Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code. |
glacier | Package glacier provides the client and types for making API requests to Amazon Glacier. |
glacieriface | Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code. |
greengrass | Package greengrass provides the client and types for making API requests to AWS Greengrass. |
greengrassiface | Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code. |
health | Package health provides the client and types for making API requests to AWS Health APIs and Notifications. |
healthiface | Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code. |
iam | Package iam provides the client and types for making API requests to AWS Identity and Access Management. |
iamiface | Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code. |
inspector | Package inspector provides the client and types for making API requests to Amazon Inspector. |
inspectoriface | Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code. |
iot | Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected things (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud. |
iotiface | Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code. |
iotdataplane | Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane. |
iotdataplaneiface | Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code. |
kinesis | Package kinesis provides the client and types for making API requests to Amazon Kinesis. |
kinesisiface | Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code. |
kinesisanalytics | Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics. |
kinesisanalyticsiface | Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. |
kms | Package kms provides the client and types for making API requests to AWS Key Management Service. |
kmsiface | Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code. |
lambda | Package lambda provides the client and types for making API requests to AWS Lambda. |
lambdaiface | Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code. |
lexmodelbuildingservice | Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service. |
lexmodelbuildingserviceiface | Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code. |
lexruntimeservice | Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service. |
lexruntimeserviceiface | Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code. |
lightsail | Package lightsail provides the client and types for making API requests to Amazon Lightsail. |
lightsailiface | Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code. |
machinelearning | Package machinelearning provides the client and types for making API requests to Amazon Machine Learning. |
machinelearningiface | Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code. |
marketplacecommerceanalytics | Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics. |
marketplacecommerceanalyticsiface | Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code. |
marketplaceentitlementservice | Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service. |
marketplaceentitlementserviceiface | Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code. |
marketplacemetering | Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering. |
marketplacemeteringiface | Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code. |
mobileanalytics | Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics. |
mobileanalyticsiface | Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code. |
mturk | Package mturk provides the client and types for making API requests to Amazon Mechanical Turk. |
mturkiface | Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code. |
opsworks | Package opsworks provides the client and types for making API requests to AWS OpsWorks. |
opsworksiface | Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code. |
opsworkscm | Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate. |
opsworkscmiface | Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code. |
organizations | Package organizations provides the client and types for making API requests to AWS Organizations. |
organizationsiface | Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code. |
pinpoint | Package pinpoint provides the client and types for making API requests to Amazon Pinpoint. |
pinpointiface | Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code. |
polly | Package polly provides the client and types for making API requests to Amazon Polly. |
pollyiface | Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code. |
rds | Package rds provides the client and types for making API requests to Amazon Relational Database Service. |
rdsiface | Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code. |
rdsutils | |
redshift | Package redshift provides the client and types for making API requests to Amazon Redshift. |
redshiftiface | Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code. |
rekognition | Package rekognition provides the client and types for making API requests to Amazon Rekognition. |
rekognitioniface | Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code. |
resourcegroupstaggingapi | Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API. |
resourcegroupstaggingapiiface | Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code. |
route53 | Package route53 provides the client and types for making API requests to Amazon Route 53. |
route53iface | Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code. |
route53domains | Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains. |
route53domainsiface | Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code. |
s3 | Package s3 provides the client and types for making API requests to Amazon Simple Storage Service. |
s3crypto | Package s3crypto provides encryption to S3 using KMS and AES GCM. |
s3iface | Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code. |
s3manager | Package s3manager provides utilities to upload and download objects from S3 concurrently. |
s3manageriface | Package s3manageriface provides an interface for the s3manager package |
servicecatalog | Package servicecatalog provides the client and types for making API requests to AWS Service Catalog. |
servicecatalogiface | Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code. |
ses | Package ses provides the client and types for making API requests to Amazon Simple Email Service. |
sesiface | Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code. |
sfn | Package sfn provides the client and types for making API requests to AWS Step Functions. |
sfniface | Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code. |
shield | Package shield provides the client and types for making API requests to AWS Shield. |
shieldiface | Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code. |
simpledb | Package simpledb provides the client and types for making API requests to Amazon SimpleDB. |
simpledbiface | Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code. |
sms | Package sms provides the client and types for making API requests to AWS Server Migration Service. |
smsiface | Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code. |
snowball | Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball. |
snowballiface | Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code. |
sns | Package sns provides the client and types for making API requests to Amazon Simple Notification Service. |
snsiface | Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code. |
sqs | Package sqs provides the client and types for making API requests to Amazon Simple Queue Service. |
sqsiface | Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code. |
ssm | Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM). |
ssmiface | Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code. |
storagegateway | Package storagegateway provides the client and types for making API requests to AWS Storage Gateway. |
storagegatewayiface | Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code. |
sts | Package sts provides the client and types for making API requests to AWS Security Token Service. |
stsiface | Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code. |
support | Package support provides the client and types for making API requests to AWS Support. |
supportiface | Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code. |
swf | Package swf provides the client and types for making API requests to Amazon Simple Workflow Service. |
swfiface | Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code. |
waf | Package waf provides the client and types for making API requests to AWS WAF. |
wafiface | Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code. |
wafregional | Package wafregional provides the client and types for making API requests to AWS WAF Regional. |
wafregionaliface | Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code. |
workdocs | Package workdocs provides the client and types for making API requests to Amazon WorkDocs. |
workdocsiface | Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code. |
workspaces | Package workspaces provides the client and types for making API requests to Amazon WorkSpaces. |
workspacesiface | Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code. |
xray | Package xray provides the client and types for making API requests to AWS X-Ray. |
xrayiface | Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code. |